Align Alpha-ketoglutarate permease, MFS superfamily (characterized)
to candidate AO353_04405 AO353_04405 MFS transporter
Query= reanno::pseudo3_N2E3:AO353_03810 (439 letters) >FitnessBrowser__pseudo3_N2E3:AO353_04405 Length = 438 Score = 226 bits (576), Expect = 1e-63 Identities = 145/428 (33%), Positives = 222/428 (51%), Gaps = 12/428 (2%) Query: 11 SAAVPAKEKTTASRIKSIFSGSVGNMVEWYDWYVYA-AFSLYFAKAFFPKGDTTAQLLNT 69 S AVPA+ + +R+ + + +G +E+YD+YVYA A +L FFP+ TAQ+L+ Sbjct: 8 SDAVPAQPTNSTTRVAT--ASFIGTAIEFYDFYVYATAAALVIGPVFFPQTSGTAQMLSA 65 Query: 70 AAIFAVGFLMRPIGGWLMGLYADRAGRKAALMASVYLMCFGSLIIALSPGYETIGVGAPI 129 F + FL RP+G L G + DR GRK+ L+AS+ LM + +I + PGYE+IG API Sbjct: 66 FLTFGIAFLARPLGSALFGHFGDRIGRKSTLVASLLLMGVCTTLIGVLPGYESIGAWAPI 125 Query: 130 LLVFARLLQGLSVGGEYGTSATYLSEMATKERRGFFSSFQYVTLISGQLIALGVLIVLQQ 189 LL R QGL +GGE+G +A +E A K +R +F F + G L A G+ + L Sbjct: 126 LLCVLRFGQGLGLGGEWGGAALLATENAPKGKRAWFGMFPQLGPSIGFLAANGLFLTLAM 185 Query: 190 TLTTEQLYDWGWRIPFAIGALCAIVALYLRRGMEETESF----AKKEKSKESAMRTLLRH 245 TL EQ WGWRIPF + A+ +V LY+R + ET F A++E+ K + ++ Sbjct: 186 TLNDEQFRSWGWRIPFLLSAVLVMVGLYVRLKLHETPVFANAMARQERVKIPLVELFSQY 245 Query: 246 PKELMTVVGLTMGGTLAFYTYTTYMQKYLVNTVGMSISDSTTISAATLFLFMCLQPIIGG 305 ++ + FY T + Y V+T+G S + + P+ Sbjct: 246 WAPMLLGAAAMVVCYALFYISTVFSLSYGVSTLGYSRETFLGLLCFAVLFMAAATPLSAW 305 Query: 306 LSDKVGRRPILIAFGILGTL--FTVPILTTLHTIQTWWGAFFLIMAALIIVSGYTSINAV 363 SD+ GR+P+LI G+L L FT+ L T T TW A FL + ++ + + A+ Sbjct: 306 ASDRFGRKPVLIIGGVLAILSGFTMEPLLTHGT--TWGVALFLCIELFLMGVTFAPMGAL 363 Query: 364 VKAELFPTEIRALGVGLPYALTVSIFGGTAEYIALWFKSIGMETGYYWYVTACIAVSLLV 423 + ELFPT +R G Y L + A + A ++G + YV+A +SL+ Sbjct: 364 L-PELFPTRVRYTGASAAYNLGGIVGASAAPFFAQKLVAMGGLSWVGGYVSAAAVISLIA 422 Query: 424 YVTMKDTR 431 + +K+TR Sbjct: 423 VLCLKETR 430 Lambda K H 0.325 0.138 0.414 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 605 Number of extensions: 35 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 439 Length of database: 438 Length adjustment: 32 Effective length of query: 407 Effective length of database: 406 Effective search space: 165242 Effective search space used: 165242 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.0 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.6 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory