GapMind for catabolism of small carbon sources

 

Aligments for a candidate for bamH in Pseudomonas fluorescens FW300-N2E3

Align Benzoyl-CoA reductase electron transfer protein, putative (characterized, see rationale)
to candidate AO353_27760 AO353_27760 NADH dehydrogenase

Query= uniprot:Q39TW5
         (635 letters)



>lcl|FitnessBrowser__pseudo3_N2E3:AO353_27760 AO353_27760 NADH
           dehydrogenase
          Length = 451

 Score =  311 bits (796), Expect = 5e-89
 Identities = 171/424 (40%), Positives = 244/424 (57%), Gaps = 15/424 (3%)

Query: 133 KNQQRNILSENLRLDSKS--MDDYLAIGGYSALSKVLFQMTPEDVMGEIKKSNLRGRGGG 190
           ++ + + L+  LR D ++  +D+Y A  GY+A  K    M+ +D++  +K S L+GRGG 
Sbjct: 14  RSAETHPLTWRLRDDGEAVWLDEYQAKNGYAAARKAFADMSQDDIVQTVKDSGLKGRGGA 73

Query: 191 GFPAWRKW-----EESRNAPDPIKYVIVNADEGDPGAFMDRALIEGNPHSILEGLIIGAY 245
           GFP   KW     +ES N    I+Y++ NADE +P  + DR L+E  PH ++EG++I A 
Sbjct: 74  GFPTGVKWGLMPKDESMN----IRYLLCNADEMEPNTWKDRMLMEQLPHLLIEGMLISAR 129

Query: 246 AVGAHEGFIYVRQEYPLAVENINLAIRQASERGFVGKDILGSGFDFTVKVHMGAGAFVCG 305
           A+  + G+I++R EY  A +++N A+ +A   G +GK+ILGSGFDF + VH GAG ++CG
Sbjct: 130 ALKTYRGYIFLRGEYTTAAKHLNRAVEEAKAAGLLGKNILGSGFDFELFVHTGAGRYICG 189

Query: 306 ESSALMTALEGRAGEPRPKYIHTAVKGVWDHPSVLNNVETWANVTQIITKGADWFTSYGT 365
           E +AL+ +LEGR   PR K    A  GVW  P+ +NNVET  NV  II  G DW+ S   
Sbjct: 190 EETALINSLEGRRANPRSKPPFPAAVGVWGKPTCVNNVETLCNVPAIIGDGVDWYKSLAR 249

Query: 366 AGST--GTKIFSLVGKITNTGLVEVPMGVTLRDIITKVGGGIPGGKKFKAVQTGGPSGGC 423
            GS   GTK+    GK+ N GL E+P GV  R++     GG+  G K K  Q GG   G 
Sbjct: 250 EGSEDHGTKLMGFSGKVKNPGLWELPFGVPARELFEDYAGGMRDGYKLKCWQPGGAGTGF 309

Query: 424 IPEAMLDLPVDFDELTKAGSMMGSGGMIVMDEDTCMVDIARYFIDFLKDESCGKCTPCRE 483
           +    LD  +    + K G+ MG+G  + +D+   MV + R   +F   ESCG CTPCR+
Sbjct: 310 LLPEHLDAQMYAGGIAKVGTRMGTGLAMAVDDSVNMVSLLRNMEEFFARESCGFCTPCRD 369

Query: 484 GIRQMLAVLTRITVGKGKEGDIELLEELAE--STGAALCALGKSAPNPVLSTIRYFRDEY 541
           G+   + +L  I  G+G+ GDIE L  L      G   CA    A  P+ S I+YFR E+
Sbjct: 370 GLPWSVKLLRAIENGEGQAGDIETLLGLVGFLGPGKTFCAHAPGAVEPLGSAIKYFRPEF 429

Query: 542 EAHI 545
           EA I
Sbjct: 430 EAGI 433


Lambda     K      H
   0.319    0.138    0.420 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 785
Number of extensions: 51
Number of successful extensions: 4
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 635
Length of database: 451
Length adjustment: 35
Effective length of query: 600
Effective length of database: 416
Effective search space:   249600
Effective search space used:   249600
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 52 (24.6 bits)

This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the preprint on GapMind for carbon sources, or view the source code.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory