Align Putative 4-hydroxy-4-methyl-2-oxoglutarate aldolase; HMG aldolase; EC 4.1.3.17; Oxaloacetate decarboxylase; OAA decarboxylase; EC 4.1.1.112; Regulator of ribonuclease activity homolog; RraA-like protein (uncharacterized)
to candidate AO353_07830 AO353_07830 dimethylmenaquinone methyltransferase
Query= curated2:Q9KBI9 (210 letters) >FitnessBrowser__pseudo3_N2E3:AO353_07830 Length = 231 Score = 125 bits (313), Expect = 8e-34 Identities = 71/185 (38%), Positives = 100/185 (54%), Gaps = 1/185 (0%) Query: 8 FITQFRTIPTTCISDALDGLTNLTSTIKPLNENDQVVGPARTVQVASGDNLAVLKAMYEA 67 ++ +F IP +SD L G +K + N ++G A TV+V GDNL +LKAM A Sbjct: 27 WLKEFSKIPAAAVSDCL-GRNVGGLGLKAFHGNAPMLGSALTVRVRPGDNLMILKAMQMA 85 Query: 68 SPGDVIVIDAKGDCTRAIAGDFVLGMAKTLGIAGFVVDGAIRDIRASKALNFPIFCRGTT 127 PGDV+VID D TRA+ G + MA GI G V++GA+RD+ + P + G Sbjct: 86 RPGDVLVIDGSADLTRAVFGGIMRAMALKAGIVGVVINGALRDLDEWQTGELPAYAIGGV 145 Query: 128 IAASKKTGIGNINVPISCGGVPIRPGDLIVGDADGVTVIPKGQEENVLQKAKKKQADDEA 187 G G INVPISC G+ + PGDL++GD DGV + + +L + A ++A Sbjct: 146 HRGPSTDGGGEINVPISCAGMLVAPGDLMIGDGDGVVAASRSELPELLVRCHDLLAREQA 205 Query: 188 RERAI 192 AI Sbjct: 206 TLAAI 210 Lambda K H 0.318 0.136 0.384 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 155 Number of extensions: 8 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 210 Length of database: 231 Length adjustment: 22 Effective length of query: 188 Effective length of database: 209 Effective search space: 39292 Effective search space used: 39292 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 45 (21.9 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory