Align 4-oxalomesaconate tautomerase; Gallate degradation protein D; EC 5.3.2.8 (characterized)
to candidate AO353_00885 AO353_00885 3-methylitaconate isomerase
Query= SwissProt::Q88JY0 (361 letters) >FitnessBrowser__pseudo3_N2E3:AO353_00885 Length = 396 Score = 200 bits (508), Expect = 6e-56 Identities = 144/394 (36%), Positives = 207/394 (52%), Gaps = 43/394 (10%) Query: 3 QTRIPCLLMRGGTSKGAYFLHDDLP----APGPLRDRVLLAVMGSPDA--RQIDGIGGAD 56 Q +IP MRGGTSKG +F DLP PGP RD +LL V+GSPD +QIDG+GGA Sbjct: 6 QIKIPATYMRGGTSKGVFFSLQDLPESAQVPGPSRDALLLRVIGSPDPYEKQIDGMGGAT 65 Query: 57 SLTSKVAIIRASQRDDADVDYLFAQVVVDEARVDYGQNCGNILAGVGPFALERGLVAAS- 115 S TSK I+ S + D DVDYLF QV +D+ VD+ NCGN+ A VG FA+ GLV AS Sbjct: 66 SSTSKTVIVSKSIKADHDVDYLFGQVSIDKPFVDWSGNCGNLSAAVGSFAISSGLVEASR 125 Query: 116 ---GASTPVRIFMENTGQIAVAQVPTADGQVEYAGDTRIDGVPGRAAALVVTFADVAG-- 170 VRI+ N G+ +A VP DG V+ GD +DGV AA + + F + A Sbjct: 126 VPRNGIAVVRIWQANIGKTIIAHVPITDGAVQETGDFELDGVTFPAAEVQLEFMNPAAEE 185 Query: 171 -ASCGALLPTGNSRDCVE-----GVEVTCIDNGMPVVLLCAEDLGVTGYEPCETLEADSA 224 + G++ PTGN D +E ++VT I+ G+P + + AE +G TG E + D Sbjct: 186 EGAGGSMFPTGNLVDDLEVPGVGTLKVTMINAGIPTIFVNAEAIGYTGTELQGDINGDPK 245 Query: 225 LKTRLEAIR----LQLGPRMNLGDVSQR-NVPKMCLLSAPRN----------GGTVN--T 267 E IR L++G NL D ++R + PK+ ++ P + G V+ Sbjct: 246 ALAMFETIRAYGALRMGLIQNLEDAAKRQHTPKVAFVARPADYLASSGKPVAAGDVDLLV 305 Query: 268 RSFIPHRCHASIGVFGAVSVATACLIEGSVAQGLASTSGGDRQRLAVEHPSGEFTV---- 323 R+ + H ++ AV++ TA I+G++ + G R + HPSG V Sbjct: 306 RALSMGKLHHAMMGTAAVAIGTAAAIDGTLVN--LAAGGIPRNAVRFGHPSGTLRVGAEA 363 Query: 324 -EISLEHGVIKGCGLVRTARLLFDGVVCIGRDTW 356 ++ E V K + R+AR+L +G V + D++ Sbjct: 364 QQVDGEWTVTKAI-MSRSARVLMEGWVRVPGDSF 396 Lambda K H 0.320 0.138 0.412 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 419 Number of extensions: 29 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 361 Length of database: 396 Length adjustment: 30 Effective length of query: 331 Effective length of database: 366 Effective search space: 121146 Effective search space used: 121146 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory