GapMind for catabolism of small carbon sources

 

Aligments for a candidate for pcaB in Pseudomonas fluorescens FW300-N2E3

Align 3-carboxy-cis,cis-muconate cycloisomerase; EC 5.5.1.2 (characterized, see rationale)
to candidate AO353_17225 AO353_17225 3-carboxy-cis,cis-muconate cycloisomerase

Query= uniprot:A0A0C4YE08
         (470 letters)



>lcl|FitnessBrowser__pseudo3_N2E3:AO353_17225 AO353_17225
           3-carboxy-cis,cis-muconate cycloisomerase
          Length = 453

 Score =  452 bits (1162), Expect = e-131
 Identities = 237/445 (53%), Positives = 297/445 (66%), Gaps = 4/445 (0%)

Query: 5   SRLTDPMFGSAATLAAFSDTATVQRMLDFEAALARAEASCGVIPADAAEAIAATCRAGEI 64
           ++L D  F +      FSD   VQ MLDFEAALARAEA  G+IPA A   I A CRA   
Sbjct: 6   NQLFDAYFTARNMREVFSDQGRVQAMLDFEAALARAEARVGLIPASAVAPIEAACRAEHY 65

Query: 65  DFDALAAAAVAGGNLAIPLVRQLTARVAARDAQAARYVHWGATSQDAIDTGMVLQLREAL 124
           DF AL  A    GN AIPLV+ L  ++AA D  A RYVH GATSQD +DTG+VLQ+R+AL
Sbjct: 66  DFAALGEAIAIAGNSAIPLVKALGKQIAAHDQDAERYVHLGATSQDVMDTGLVLQVRQAL 125

Query: 125 QAVDADLKALGHACAALAAQHRDTPMVARTWLQHALPTTFGLKAAGWLDALRRDLRRLDA 184
             +D+DL  LG A A  A  H  TP+  RTWLQHA P T G+K AGWL A+ R  +RL A
Sbjct: 126 HLIDSDLARLGEALAIQARHHVLTPLAGRTWLQHATPVTLGMKVAGWLGAVTRSRQRLHA 185

Query: 185 ARAQAATLQFGGAAGTLASLGAAAPAVATALGSALSLAVAPTPWHAYRDRMVEVATTLGM 244
            + +   LQFGGA+GTLA+LG  A  +A AL   L L +   PWH  RDR+VE    LG+
Sbjct: 186 LKPRLLVLQFGGASGTLAALGEQAMPIAEALAQELQLTLPEQPWHTQRDRLVEFGAALGL 245

Query: 245 LTGSLGKIARDVSLMMQTEVAEVAEPTGPGRGGSSTMPHKRNPVGCAAVLTAAVRVPPLV 304
           + GSLGK+ RD+SL+MQTE AEV EP+ PG+GGSSTMPHKRNPVG A ++ AA RVP L+
Sbjct: 246 IAGSLGKLGRDISLLMQTEAAEVFEPSAPGKGGSSTMPHKRNPVGAAVLIGAATRVPGLL 305

Query: 305 ATMLAGMVQEHERALGGWQAEWDTLPQIVTLAAGALRQMLEVVGGLQVDAARMRANLGVT 364
           +T+ + M QEHER+LG W AEW+TLP+I  L +GAL+Q L +  GL+VDA RM  NL +T
Sbjct: 306 STLFSAMPQEHERSLGLWHAEWETLPEICCLVSGALQQALLITEGLEVDAERMAQNLDLT 365

Query: 365 HGLILAEAAMLELGGKIGRLPAHHLVEGACRRAVAEGTTLRQALGATLAEDAAHAGLMDA 424
            GL+LAEA  + L  +IGR  AHHL+E  C+RAVAE   LR  LG    ++      + +
Sbjct: 366 QGLVLAEAVSIVLAQRIGRDKAHHLLELCCKRAVAEQRHLRAVLG----DEPQVTAELSS 421

Query: 425 AALDRVCDPANYAGQAAGFVDAVLA 449
           A LD++ +PA+Y GQA  +V+  LA
Sbjct: 422 AELDQLMNPAHYLGQAQTWVERALA 446


Lambda     K      H
   0.319    0.130    0.380 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 474
Number of extensions: 14
Number of successful extensions: 2
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 470
Length of database: 453
Length adjustment: 33
Effective length of query: 437
Effective length of database: 420
Effective search space:   183540
Effective search space used:   183540
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 51 (24.3 bits)

Align candidate AO353_17225 AO353_17225 (3-carboxy-cis,cis-muconate cycloisomerase)
to HMM TIGR02426 (pcaB: 3-carboxy-cis,cis-muconate cycloisomerase (EC 5.5.1.2))

# hmmsearch :: search profile(s) against a sequence database
# HMMER 3.3.1 (Jul 2020); http://hmmer.org/
# Copyright (C) 2020 Howard Hughes Medical Institute.
# Freely distributed under the BSD open source license.
# - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
# query HMM file:                  ../tmp/path.carbon/TIGR02426.hmm
# target sequence database:        /tmp/gapView.7600.genome.faa
# - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query:       TIGR02426  [M=338]
Accession:   TIGR02426
Description: protocat_pcaB: 3-carboxy-cis,cis-muconate cycloisomerase
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence                                     Description
    ------- ------ -----    ------- ------ -----   ---- --  --------                                     -----------
   1.2e-146  473.9  11.8   1.6e-146  473.5  11.8    1.2  1  lcl|FitnessBrowser__pseudo3_N2E3:AO353_17225  AO353_17225 3-carboxy-cis,cis-mu


Domain annotation for each sequence (and alignments):
>> lcl|FitnessBrowser__pseudo3_N2E3:AO353_17225  AO353_17225 3-carboxy-cis,cis-muconate cycloisomerase
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  473.5  11.8  1.6e-146  1.6e-146       1     338 []       8     351 ..       8     351 .. 0.99

  Alignments for each domain:
  == domain 1  score: 473.5 bits;  conditional E-value: 1.6e-146
                                     TIGR02426   1 lldglfgdseaaelfsdrarlramldvEaalaraqadvGlipaeaaeaiaaaaaelalDlealae 65 
                                                   l+d++f++ +++e+fsd++r++amld+Eaalara+a+vGlipa+a++ i+aa+++ ++D +al e
  lcl|FitnessBrowser__pseudo3_N2E3:AO353_17225   8 LFDAYFTARNMREVFSDQGRVQAMLDFEAALARAEARVGLIPASAVAPIEAACRAEHYDFAALGE 72 
                                                   7899************************************************************* PP

                                     TIGR02426  66 aaaeagnvviplvkalrkavae...eaaryvHlGaTSQDviDTalmLqlrdaldllladlerlae 127
                                                   a+a agn++iplvkal k++a+   +a+ryvHlGaTSQDv+DT+l+Lq+r+al+l++ dl+rl e
  lcl|FitnessBrowser__pseudo3_N2E3:AO353_17225  73 AIAIAGNSAIPLVKALGKQIAAhdqDAERYVHLGATSQDVMDTGLVLQVRQALHLIDSDLARLGE 137
                                                   *********************99999*************************************** PP

                                     TIGR02426 128 aLaelaarhrdtpltarTllQqAvpttvglkaagwlaavlrardrlealrtealalqfGGAaGtl 192
                                                   aLa +a++h  tpl +rT+lQ+A+p+t+g+k+agwl av+r+r+rl+al+ ++l+lqfGGA+Gtl
  lcl|FitnessBrowser__pseudo3_N2E3:AO353_17225 138 ALAIQARHHVLTPLAGRTWLQHATPVTLGMKVAGWLGAVTRSRQRLHALKPRLLVLQFGGASGTL 202
                                                   ***************************************************************** PP

                                     TIGR02426 193 aalekkglavaealAaelgLeapalpWhtqrdriaelaaaLalvagalgkiaqDvallaqtevge 257
                                                   aal+++++ +aealA+el+L++p++pWhtqrdr++e++aaL+l+ag+lgk+++D++ll+qte++e
  lcl|FitnessBrowser__pseudo3_N2E3:AO353_17225 203 AALGEQAMPIAEALAQELQLTLPEQPWHTQRDRLVEFGAALGLIAGSLGKLGRDISLLMQTEAAE 267
                                                   ***************************************************************** PP

                                     TIGR02426 258 vle.agg..GGSSampHKrNPvaaevlaaaarrapglvatLfaalaqedeRsaggWhaeWetLre 319
                                                   v+e +++  GGSS+mpHKrNPv+a+vl++aa+r+pgl++tLf+a++qe+eRs+g WhaeWetL+e
  lcl|FitnessBrowser__pseudo3_N2E3:AO353_17225 268 VFEpSAPgkGGSSTMPHKRNPVGAAVLIGAATRVPGLLSTLFSAMPQEHERSLGLWHAEWETLPE 332
                                                   ***766689******************************************************** PP

                                     TIGR02426 320 lvaltagalrqaaellegl 338
                                                   +++l++gal+qa  + egl
  lcl|FitnessBrowser__pseudo3_N2E3:AO353_17225 333 ICCLVSGALQQALLITEGL 351
                                                   ************9999987 PP



Internal pipeline statistics summary:
-------------------------------------
Query model(s):                            1  (338 nodes)
Target sequences:                          1  (453 residues searched)
Passed MSV filter:                         1  (1); expected 0.0 (0.02)
Passed bias filter:                        1  (1); expected 0.0 (0.02)
Passed Vit filter:                         1  (1); expected 0.0 (0.001)
Passed Fwd filter:                         1  (1); expected 0.0 (1e-05)
Initial search space (Z):                  1  [actual number of targets]
Domain search space  (domZ):               1  [number of targets reported over threshold]
# CPU time: 0.01u 0.01s 00:00:00.02 Elapsed: 00:00:00.01
# Mc/sec: 7.96
//
[ok]

This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the preprint on GapMind for carbon sources, or view the source code.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory