Align protocatechuate 3,4-dioxygenase (subunit 1/2) (EC 1.13.11.3) (characterized)
to candidate AO353_17215 AO353_17215 protocatechuate 3,4-dioxygenase
Query= BRENDA::A0A193DXP2 (246 letters) >FitnessBrowser__pseudo3_N2E3:AO353_17215 Length = 188 Score = 95.9 bits (237), Expect = 5e-25 Identities = 52/163 (31%), Positives = 85/163 (52%), Gaps = 8/163 (4%) Query: 40 ISLEGTKSEITGPVFGHGMLNPLDNDLILNYARPGEMPVGPRILVHGRVLDERGRGVDGA 99 ++L T S GP + G+ +L + E +G R+ + G+V+D G V+ A Sbjct: 1 MTLNATTSHTVGPYYHIGLTWLNRENLTV------EQTLGERVTITGQVVDGNGDFVNDA 54 Query: 100 LVEFWQANAGGRYRHKKESYLAAIDPNFGGVGRTITDENGYYWFKTIQPGAYPWPNGVND 159 ++E WQANA G+Y H ++ +DPNF G GR D G + F TI+PG P G Sbjct: 55 MLEVWQANAAGKYDHPEDEQDKPLDPNFEGFGRVPVDAEGRFRFTTIKPGTVPGLKG--S 112 Query: 160 WRPAHIHFSIFGHGFAQRLITQMYFEGDPLIWKCPIVKTIPDE 202 + H+ +F G + L+T++YF+G+ P++ +P+E Sbjct: 113 TQAPHLVVLVFARGLVKHLLTRIYFDGELANTSDPLLACVPEE 155 Lambda K H 0.322 0.142 0.457 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 155 Number of extensions: 11 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 246 Length of database: 188 Length adjustment: 22 Effective length of query: 224 Effective length of database: 166 Effective search space: 37184 Effective search space used: 37184 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 45 (21.9 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory