GapMind for catabolism of small carbon sources

 

Aligments for a candidate for pobA in Pseudomonas fluorescens FW300-N2E3

Align 4-hydroxybenzoate 3-monooxygenase (EC 1.14.13.2) (characterized)
to candidate AO353_03895 AO353_03895 4-hydroxybenzoate 3-monooxygenase

Query= reanno::pseudo6_N2E2:Pf6N2E2_2914
         (396 letters)



>lcl|FitnessBrowser__pseudo3_N2E3:AO353_03895 AO353_03895
           4-hydroxybenzoate 3-monooxygenase
          Length = 397

 Score =  688 bits (1776), Expect = 0.0
 Identities = 339/397 (85%), Positives = 363/397 (91%), Gaps = 1/397 (0%)

Query: 1   MKTLKTQVAIIGAGPSGLLLGQLLHNAGIDTVILERQTPEYVLSRIRAGVLEQGMVELLR 60
           MKTLKTQVAIIGAGPSGLLLGQLLHNAGI TVI+ERQTP+YVL RIRAGVLEQGMVELLR
Sbjct: 1   MKTLKTQVAIIGAGPSGLLLGQLLHNAGIATVIVERQTPDYVLGRIRAGVLEQGMVELLR 60

Query: 61  QAGVGQRMDAEGLPHDGFELVLNDRRVHIDLKGLTGGKNVMVYGQTEVTRDLMAAREAAG 120
           QAGV QRMDAEGL H GF+L L+ R+VHIDL  LTGGK VM+YGQTEVTRDLMAAR++AG
Sbjct: 61  QAGVSQRMDAEGLVHGGFQLALDGRQVHIDLHALTGGKTVMIYGQTEVTRDLMAARQSAG 120

Query: 121 ARTLYLASNAQPHDMQTQTPFVTFEHEGETWRLDCDYIAGCDGFHGVARQSIPAEKLKVF 180
           A TLY ASN  PH M++  PF+TFE +GETWRLDCDYIAGCDGFHGVARQSIPA+ L +F
Sbjct: 121 ASTLYEASNVMPHGMKSAEPFLTFEKDGETWRLDCDYIAGCDGFHGVARQSIPADTLNIF 180

Query: 181 ERVYPFGWLGVLADTPPVHEELVYARHTRGFALCSMRSKTRTRYYLQVPAEEQVADWPDE 240
           ERVYPFGWLG+LADTPPVH+ELVYARH RGFALCSMRS TRTRYY+QVPA+E+V DW D+
Sbjct: 181 ERVYPFGWLGILADTPPVHDELVYARHARGFALCSMRSTTRTRYYVQVPADEKVEDWSDQ 240

Query: 241 RFWGELKNRLPADLAAALVTGPSIEKSIAPLRSFVVEPMQYGRMFLVGDAAHIVPPTGAK 300
           RFW ELK+RLP  LA  LVTGPSIEKSIAPLRSFVVEPMQYGRMFLVGDAAHIVPPTGAK
Sbjct: 241 RFWEELKSRLPQALADTLVTGPSIEKSIAPLRSFVVEPMQYGRMFLVGDAAHIVPPTGAK 300

Query: 301 GLNLAASDVSTLFNILLKVYRDGRVELLEKYSAICLRRVWKAERFSWWMTSMLHRFD-DD 359
           GLNLAASDVSTLFNILLKVYRDGR ELLEKYS ICLRRVWKAERFSWWMTSMLH F+  D
Sbjct: 301 GLNLAASDVSTLFNILLKVYRDGRTELLEKYSEICLRRVWKAERFSWWMTSMLHTFEGSD 360

Query: 360 AFNQRISEAELEYFVDSEAGRKTIAENYVGLPYEAIE 396
           AF+QRISE+ELEYFVDSEAGRKTIAENYVGLPYEAIE
Sbjct: 361 AFSQRISESELEYFVDSEAGRKTIAENYVGLPYEAIE 397


Lambda     K      H
   0.321    0.137    0.415 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 630
Number of extensions: 11
Number of successful extensions: 2
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 396
Length of database: 397
Length adjustment: 31
Effective length of query: 365
Effective length of database: 366
Effective search space:   133590
Effective search space used:   133590
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.9 bits)
S2: 50 (23.9 bits)

Align candidate AO353_03895 AO353_03895 (4-hydroxybenzoate 3-monooxygenase)
to HMM TIGR02360 (pobA: 4-hydroxybenzoate 3-monooxygenase (EC 1.14.13.2))

# hmmsearch :: search profile(s) against a sequence database
# HMMER 3.3.1 (Jul 2020); http://hmmer.org/
# Copyright (C) 2020 Howard Hughes Medical Institute.
# Freely distributed under the BSD open source license.
# - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
# query HMM file:                  ../tmp/path.carbon/TIGR02360.hmm
# target sequence database:        /tmp/gapView.6421.genome.faa
# - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query:       TIGR02360  [M=390]
Accession:   TIGR02360
Description: pbenz_hydroxyl: 4-hydroxybenzoate 3-monooxygenase
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence                                     Description
    ------- ------ -----    ------- ------ -----   ---- --  --------                                     -----------
   6.3e-209  679.5   0.0   7.3e-209  679.3   0.0    1.0  1  lcl|FitnessBrowser__pseudo3_N2E3:AO353_03895  AO353_03895 4-hydroxybenzoate 3-


Domain annotation for each sequence (and alignments):
>> lcl|FitnessBrowser__pseudo3_N2E3:AO353_03895  AO353_03895 4-hydroxybenzoate 3-monooxygenase
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  679.3   0.0  7.3e-209  7.3e-209       1     390 []       4     393 ..       4     393 .. 1.00

  Alignments for each domain:
  == domain 1  score: 679.3 bits;  conditional E-value: 7.3e-209
                                     TIGR02360   1 mktqvaiigaGpsGlllgqllhkaGidavilerksrdyvlgriraGvleqgtvdlleeagvderl 65 
                                                   +ktqvaiigaGpsGlllgqllh+aGi++vi+er+++dyvlgriraGvleqg+v+ll++agv++r+
  lcl|FitnessBrowser__pseudo3_N2E3:AO353_03895   4 LKTQVAIIGAGPSGLLLGQLLHNAGIATVIVERQTPDYVLGRIRAGVLEQGMVELLRQAGVSQRM 68 
                                                   69*************************************************************** PP

                                     TIGR02360  66 dreglvheGveiafegekvrvdlkkltggksvlvyGqtevtrdlyeareaaglktvyeadevrlh 130
                                                   d+eglvh G+++a +g++v++dl++ltggk+v++yGqtevtrdl+ ar+ ag++t+yea +v +h
  lcl|FitnessBrowser__pseudo3_N2E3:AO353_03895  69 DAEGLVHGGFQLALDGRQVHIDLHALTGGKTVMIYGQTEVTRDLMAARQSAGASTLYEASNVMPH 133
                                                   ***************************************************************** PP

                                     TIGR02360 131 dlesdrpkvtfekdgeekrldcdfiaGcdGfhGvsrksipaeklkefekvypfGwlGilsetppv 195
                                                    ++s +p +tfekdge+ rldcd+iaGcdGfhGv+r+sipa++l+ fe+vypfGwlGil++tppv
  lcl|FitnessBrowser__pseudo3_N2E3:AO353_03895 134 GMKSAEPFLTFEKDGETWRLDCDYIAGCDGFHGVARQSIPADTLNIFERVYPFGWLGILADTPPV 198
                                                   ***************************************************************** PP

                                     TIGR02360 196 sdeliysnserGfalcslrsetrsryyvqvsltdkvedwsddrfweelkrrldeeaaeklvtgps 260
                                                   +del+y++++rGfalcs+rs+tr+ryyvqv+ ++kvedwsd+rfweelk+rl++  a++lvtgps
  lcl|FitnessBrowser__pseudo3_N2E3:AO353_03895 199 HDELVYARHARGFALCSMRSTTRTRYYVQVPADEKVEDWSDQRFWEELKSRLPQALADTLVTGPS 263
                                                   ***************************************************************** PP

                                     TIGR02360 261 ieksiaplrsfvaepmryGrlflaGdaahivpptGakGlnlaasdvaylyealleaykekdsagl 325
                                                   ieksiaplrsfv+epm+yGr+fl+GdaahivpptGakGlnlaasdv++l++ ll+ y++++++ l
  lcl|FitnessBrowser__pseudo3_N2E3:AO353_03895 264 IEKSIAPLRSFVVEPMQYGRMFLVGDAAHIVPPTGAKGLNLAASDVSTLFNILLKVYRDGRTELL 328
                                                   ***************************************************************** PP

                                     TIGR02360 326 erysakalarvwkaerfswwltsllhrfpdedefdkkiqqaeleylleseaaqktlaenyvGlpy 390
                                                   e+ys+ +l+rvwkaerfsww+ts+lh f+  d+f+++i ++eley+++sea++kt+aenyvGlpy
  lcl|FitnessBrowser__pseudo3_N2E3:AO353_03895 329 EKYSEICLRRVWKAERFSWWMTSMLHTFEGSDAFSQRISESELEYFVDSEAGRKTIAENYVGLPY 393
                                                   ****************************************************************9 PP



Internal pipeline statistics summary:
-------------------------------------
Query model(s):                            1  (390 nodes)
Target sequences:                          1  (397 residues searched)
Passed MSV filter:                         1  (1); expected 0.0 (0.02)
Passed bias filter:                        1  (1); expected 0.0 (0.02)
Passed Vit filter:                         1  (1); expected 0.0 (0.001)
Passed Fwd filter:                         1  (1); expected 0.0 (1e-05)
Initial search space (Z):                  1  [actual number of targets]
Domain search space  (domZ):               1  [number of targets reported over threshold]
# CPU time: 0.02u 0.01s 00:00:00.03 Elapsed: 00:00:00.02
# Mc/sec: 6.99
//
[ok]

This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the paper from 2022 on GapMind for carbon sources, or view the source code.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory