Align Branched-chain amino acid ABC transporter,substrate-binding periplasmic component (characterized, see rationale)
to candidate AO353_17125 AO353_17125 leucine ABC transporter substrate-binding protein
Query= uniprot:G8ALJ3 (366 letters) >FitnessBrowser__pseudo3_N2E3:AO353_17125 Length = 375 Score = 280 bits (715), Expect = 6e-80 Identities = 145/352 (41%), Positives = 208/352 (59%), Gaps = 1/352 (0%) Query: 11 VAATAMTASVAKADIAVATAGPITGQYATFGEQMKKGIEQAVADINAAGGVLGQKLKLEV 70 V A + S A I + AGP TG +G+ G + A+ INA GGV G+ L+ + Sbjct: 16 VLAGVASHSFAADTIKIGIAGPKTGPVTQYGDMQFIGAKMAIEQINAKGGVDGKMLEAKE 75 Query: 71 GDDACDPKQAVAVANQLAKAGVKFVAGHFCSGSSIPASQVYAEEGVLQISPASTNPKLTE 130 DDACDPKQAVAVAN++ GVKFV GH CS S+ PAS +Y +EGV+ I+PA+T+P +T Sbjct: 76 YDDACDPKQAVAVANKVVNDGVKFVVGHLCSSSTQPASDIYEDEGVIMITPAATSPDITN 135 Query: 131 QNLKNVFRVCGRDDQQGQIAGKYLLENYKGKNVAILHDKSAYGKGLADETQKALNAGGQK 190 + K VFR G D QG AG Y+ ++ K K VA+LHDK YG+G+A +K L G K Sbjct: 136 RGYKMVFRTIGLDSAQGPAAGNYIADHVKPKIVAVLHDKQQYGEGIATAVKKTLEGKGVK 195 Query: 191 EKIYEAYTAGEKDYSALVSKLKQEAVDVVYVGGYHTEAGLLARQMKDQGLNAPIVSGDAL 250 ++E AG+KD+S+++ KLKQ VD VY GGYH E GL+ RQ K++GLNA + + + Sbjct: 196 VAVFEGLNAGDKDFSSIIQKLKQANVDFVYYGGYHPELGLILRQAKEKGLNAKFMGPEGV 255 Query: 251 VTNEYWAITGPAGENTMMTFGPDPREMPEAKEAVEKFRKAGYEPEG-YTLYTYAALQIWA 309 I A E ++T + P K V+ F +P G + Y+A+++ A Sbjct: 256 GNESISQIAQDASEGLLVTLPKSFDQDPANKALVDAFAAKKQDPTGPFVFPAYSAVEVIA 315 Query: 310 EAAKQANSTDSAKIADVLRKNSYNTVIGKIGFDAKGDVTSPAYVWYRWNNGQ 361 E K A S D+AK+A + ++ T G + +DAKGD+ + +V Y+W+ G+ Sbjct: 316 EGIKAAKSEDTAKVAAAIHAGTFKTPTGDLSYDAKGDLKNFKFVVYQWHFGK 367 Lambda K H 0.312 0.129 0.366 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 413 Number of extensions: 22 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 366 Length of database: 375 Length adjustment: 30 Effective length of query: 336 Effective length of database: 345 Effective search space: 115920 Effective search space used: 115920 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.2 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (21.9 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory