Align D-lactate dehydrogenase (EC 1.1.1.28) (characterized)
to candidate AO353_23780 AO353_23780 hydroxyacid dehydrogenase
Query= BRENDA::Q9I530 (329 letters) >FitnessBrowser__pseudo3_N2E3:AO353_23780 Length = 317 Score = 129 bits (323), Expect = 1e-34 Identities = 97/287 (33%), Positives = 140/287 (48%), Gaps = 32/287 (11%) Query: 43 QGFEVVCAFVNDDL-------SRPVLERLAAGGTRLVALRSAGYNHVDLAAAEALGLPVV 95 Q FEV+C L + P L+ L GG R A +DL AA ALG+ V Sbjct: 48 QSFEVICVMRERTLFDEALLRNLPKLKLLVTGGMRNAA--------IDLKAAAALGIQVC 99 Query: 96 HVPAYSPHAVAEHAVGLILTLNRRLHRAYNRTREGDFSLHGLTGFDLHGKRVGVIGTGQI 155 +Y A E LI+ L R L N R G + GL G DL+GK +G++G G I Sbjct: 100 GTDSYK-QAAPELTWTLIMALTRNLLAEANALRAGHWQ-QGLGG-DLYGKTLGILGLGSI 156 Query: 156 GETFARIMAGFGCELLAY-DPYPNPRIQALGGRYLALDALLAESDIVSLHCPLTADTRHL 214 G+ A FG ++A+ + R G +++ L ++D++S+H L+ +R L Sbjct: 157 GKRIAEFGQVFGMRVIAWSENLTAERAAEAGVTFVSKRELFEQADVLSIHLVLSERSRGL 216 Query: 215 IDAQRLATMKPGAMLINTGRGALVNAAALIEALKSGQLGYLGLDVYEEEADIFFEDRSDQ 274 +D Q L MKP A+LINT RG +V+ AALI+AL+ +L LDV+E E Sbjct: 217 VDEQALGWMKPSALLINTARGPIVDEAALIQALEQNRLKGAALDVFERE----------- 265 Query: 275 PLQDDVLARLLSFPNVVVTAHQAFLTREALAAIADTTLDNIAAWQDG 321 PL D R L PNV+ T H +++ + +++I AW G Sbjct: 266 PLAADHPFRTL--PNVLATPHVGYVSEQNYRLFFSQMIEDIQAWTTG 310 Lambda K H 0.323 0.137 0.402 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 248 Number of extensions: 18 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 329 Length of database: 317 Length adjustment: 28 Effective length of query: 301 Effective length of database: 289 Effective search space: 86989 Effective search space used: 86989 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.5 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (22.0 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory