Align D-lactate transporter, ATP-binding component (characterized)
to candidate AO353_17110 AO353_17110 ABC transporter ATP-binding protein
Query= reanno::Phaeo:GFF1248 (251 letters) >FitnessBrowser__pseudo3_N2E3:AO353_17110 Length = 255 Score = 185 bits (470), Expect = 7e-52 Identities = 93/251 (37%), Positives = 157/251 (62%), Gaps = 3/251 (1%) Query: 3 ILEVKNVGKRFGGLQALSDVNLSVRENTVHAIIGPNGAGKSTLLNCLVGKLIPDTGSVMF 62 IL+V+ + RFGGL A++ V LSV+E V ++IGPNGAGK+T+ NCL G P G++ Sbjct: 5 ILKVEGLSMRFGGLLAVNSVALSVKEKQVVSMIGPNGAGKTTVFNCLTGFYKPTAGTIQL 64 Query: 63 DGKSVLGRAPYEINQMGISRVFQTPEIFGDLSVLENMMIPCFAKRDGAFEMNAISAVS-- 120 +G+++ G ++I G+ R FQ +F +++ +EN++I + F + Sbjct: 65 NGEAIEGLPGHKIAGKGVVRTFQNVRLFKEMTAVENLLIAQHRHLNTNFLAGLFKTPAFR 124 Query: 121 -GQRDILEKAEHMLEEMNMADKRHMNAASMSRGDKRRLEIGMCLSQEPRLLLLDEPTAGM 179 +R+ +E AE L+++N+ + + A +++ G +RRLEI C+ P +L+LDEP AG+ Sbjct: 125 RSEREAMEYAEFWLDKVNLKEFANRPAGTLAYGQQRRLEIARCMMTRPSILMLDEPAAGL 184 Query: 180 ARADTNNTIDLLKQIKSERDITIAIIEHDMHVVFSLADRITVLAQGTPLVEDDPQNIKGN 239 +T++ L+ ++ E ++T+ +IEHDM +V S++D I V+ QGTPL P+ I+ N Sbjct: 185 NPRETDDLKALIGTLREEHNVTVLLIEHDMKLVMSISDHIFVINQGTPLANGTPEQIRDN 244 Query: 240 PKVREAYLGES 250 P+V +AYLGE+ Sbjct: 245 PEVIKAYLGEA 255 Lambda K H 0.318 0.135 0.379 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 166 Number of extensions: 4 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 251 Length of database: 255 Length adjustment: 24 Effective length of query: 227 Effective length of database: 231 Effective search space: 52437 Effective search space used: 52437 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory