Align D-serine transporter DsdX; D-serine-specific permease (characterized)
to candidate AO353_25205 AO353_25205 permease DsdX
Query= SwissProt::A0A0H2VAP9 (445 letters) >FitnessBrowser__pseudo3_N2E3:AO353_25205 Length = 447 Score = 384 bits (986), Expect = e-111 Identities = 212/440 (48%), Positives = 288/440 (65%), Gaps = 11/440 (2%) Query: 10 TLLISIVLIVLTIVKFKFHPFLALLLASFFVGTMMGMGPLDMVNAIESGIGGTLGFLAAV 69 TL SI+LIV+ I KF+ HPFL+L+ AS VG GM P +V+A E G+G TLGFLA + Sbjct: 9 TLGASILLIVVLIGKFRVHPFLSLIAASLLVGIGTGMAPTAIVSAFEKGMGSTLGFLAGI 68 Query: 70 IGLGTILGKMMEVSGAAERIGLTLQRCRW-LSADVIMVLVGLICGITLFVEVGVVLLIPL 128 IGLG+ILGK++E SG A+RI TL R +A M+LVG I GI +F EVG VLLIPL Sbjct: 69 IGLGSILGKLLEESGGAKRIATTLLRVLGEKNASWAMMLVGFIAGIPVFFEVGFVLLIPL 128 Query: 129 AFSIAKKTNTSLLKLAIPLCTALMAVHCVVPPHPAALYVANKLGADIGSVIVYGLLVGLM 188 + +A++T ++L L +PL +LM VHC++PPHPAA + L ADIG VI+YGL+VGL Sbjct: 129 IYVVARQTRINVLYLGVPLAISLMVVHCILPPHPAATAITGMLNADIGKVILYGLIVGLP 188 Query: 189 ASLIGGPLFLKFLGQR------LPFKPVPTEFADLKVRDEKTLPSLGATLFTVLLPIALM 242 ++I GP++++ R F +E V D+ PS G + TVLLP+ALM Sbjct: 189 TAVIAGPIWVRLTCTREAPEGQAQFLAARSE----AVIDDSKAPSFGIAMVTVLLPLALM 244 Query: 243 LVKTIAELNMARESGLYTLLEFIGNPITATFIAVFVAYYVLGIRQHMSMGTMLTHTENGF 302 + KT+A + + S + FIGNP+ A +++ AY+ LG+R+ + MG +L T F Sbjct: 245 VGKTLAAPLLTKGSMTLEWVSFIGNPLIALALSICFAYWSLGLRRGLGMGALLNLTNRCF 304 Query: 303 GSIANILLIIGAGGAFNAILKSSSLADTLAVILSNMHMHPILLAWLVALILHAAVGSATV 362 +A ILLIIGAGGAFN +L S + LA +L ++PI+LAWL+A ++H AVGSATV Sbjct: 305 PPLAGILLIIGAGGAFNDMLVGSGIGKALADVLGQSQINPIILAWLIAGLMHFAVGSATV 364 Query: 363 AMMGATAIVAPMLPLYPDISPEIIAIAIGSGAIGCTIVTDSLFWLVKQYCGATLNETFKY 422 AM+ +V P+L +P+ SPEI+ IAIG+GAIG T VTDS FW+VK+Y G L+E K Sbjct: 365 AMISTAGMVLPILGQHPEYSPEILVIAIGAGAIGWTHVTDSAFWVVKEYLGIPLSEAIKK 424 Query: 423 YTTATFIASVIALAGTFLLS 442 +T AT +AS AL T +LS Sbjct: 425 FTGATVLASSAALVFTLILS 444 Lambda K H 0.328 0.142 0.417 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 622 Number of extensions: 27 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 445 Length of database: 447 Length adjustment: 32 Effective length of query: 413 Effective length of database: 415 Effective search space: 171395 Effective search space used: 171395 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.8 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory