Align isobutanoate/2-methylbutanoate--CoA ligase (EC 6.2.1.1) (characterized)
to candidate AO353_03315 AO353_03315 long-chain fatty acid--CoA ligase
Query= metacyc::MONOMER-20125 (556 letters) >FitnessBrowser__pseudo3_N2E3:AO353_03315 Length = 562 Score = 138 bits (348), Expect = 5e-37 Identities = 109/374 (29%), Positives = 176/374 (47%), Gaps = 36/374 (9%) Query: 185 DPMILNYTSGTTSSPKGVVHCHRGIFIMTVDS---LIDWGVPKQP-------VYLWTLPM 234 D +L YT GTT KG + H + + L +G +P V + LP+ Sbjct: 208 DVAVLQYTGGTTGLAKGAMLTHGNLVANMQQARACLGQFGSDGKPLLREGQEVMIAPLPL 267 Query: 235 FHANGWSYPWGMAAVGGTNICLRKFDSEI--IYDMIKRHGVTHMCGAPVVLNMLSNAPGS 292 +H ++ V G + L +I +K + + G + L + P Sbjct: 268 YHIYAFTANCMCMMVTGNHNVLITNPRDIAGFIKELKNWRFSALLGLNTLFVALMDHPNF 327 Query: 293 EPLKTTVQIMT--AGAPPPSAVLFRTESL-GFAVSHGYGLTETAGLVVSCAWKKEWNHLP 349 + L + +T G A R E + G ++ GYGLTET+ V+C P Sbjct: 328 KTLDFSSLKLTNSGGTALVKATAERWEQITGCRITEGYGLTETSP--VACT-------NP 378 Query: 350 ATERARLKSRQGVGTV-MQTKIDVVDPVTGAAVKRDGSTLGEVVLRGGSVMLGYLKDPEG 408 +++R +GTV + + + V++ GE+ ++G +M GY + PE Sbjct: 379 YGDKSR------IGTVGLPVPGTTLKVINDDGVEQPLGERGELCIKGPQIMKGYWQKPEA 432 Query: 409 TAKSMTADGWFYTGDVGVMHPDGYLEIKDRSKDVIISGGENLSSVEVESILYSHPDILEA 468 TA+ + ADGWF +GD+ V+ PDG++ I DR KD+II G N+ E+E ++ +HP + Sbjct: 433 TAEVLDADGWFKSGDIAVIDPDGFVRIVDRKKDMIIVSGFNVYPNEIEDVVMAHPKVANC 492 Query: 469 AVVARPDEFWGETPCAFVSLKK-GLTKKPTEKEIVEYCRSKLPRYMVPKTVVFKEELPKT 527 AV+ PDE GE FV ++ G++ +E+ YC+ Y VPK +V +E LP T Sbjct: 493 AVIGVPDERSGEAVKLFVVAREAGISL----EELKAYCKENFTAYKVPKHIVLRESLPMT 548 Query: 528 STGKVQKFILRDMA 541 GK+ + LRD+A Sbjct: 549 PVGKILRRELRDIA 562 Lambda K H 0.319 0.135 0.412 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 752 Number of extensions: 45 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 2 Number of HSP's successfully gapped: 1 Length of query: 556 Length of database: 562 Length adjustment: 36 Effective length of query: 520 Effective length of database: 526 Effective search space: 273520 Effective search space used: 273520 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 53 (25.0 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory