GapMind for catabolism of small carbon sources

 

Aligments for a candidate for nagA in Pseudomonas fluorescens FW300-N2E3

Align N-acetylglucosamine-6-phosphate deacetylase (EC 3.5.1.25) (characterized)
to candidate AO353_04450 AO353_04450 N-acetylglucosamine-6-phosphate deacetylase

Query= reanno::pseudo3_N2E3:AO353_04450
         (368 letters)



>lcl|FitnessBrowser__pseudo3_N2E3:AO353_04450 AO353_04450
           N-acetylglucosamine-6-phosphate deacetylase
          Length = 368

 Score =  744 bits (1922), Expect = 0.0
 Identities = 368/368 (100%), Positives = 368/368 (100%)

Query: 1   MSEDNILTAQGWIRGRLIHEHGKIVRIEGQPCDPADNDLPYLLPGFIDLHVHGGGGKDIM 60
           MSEDNILTAQGWIRGRLIHEHGKIVRIEGQPCDPADNDLPYLLPGFIDLHVHGGGGKDIM
Sbjct: 1   MSEDNILTAQGWIRGRLIHEHGKIVRIEGQPCDPADNDLPYLLPGFIDLHVHGGGGKDIM 60

Query: 61  EGTPAFDTITKTHVRFGTTSLLATTMTAPPEEISRVLAEVGEFCEQRPKGCARVLGVHLE 120
           EGTPAFDTITKTHVRFGTTSLLATTMTAPPEEISRVLAEVGEFCEQRPKGCARVLGVHLE
Sbjct: 61  EGTPAFDTITKTHVRFGTTSLLATTMTAPPEEISRVLAEVGEFCEQRPKGCARVLGVHLE 120

Query: 121 GPYINPGKLGAQPNFAHTALMAEVEAYLALAPIRVITIAPEIAGHDKLIRALSDRGIRMQ 180
           GPYINPGKLGAQPNFAHTALMAEVEAYLALAPIRVITIAPEIAGHDKLIRALSDRGIRMQ
Sbjct: 121 GPYINPGKLGAQPNFAHTALMAEVEAYLALAPIRVITIAPEIAGHDKLIRALSDRGIRMQ 180

Query: 181 IGHTLGSYEEGVAALEAGASSFTHLYNAMSPLHHREPGIVGAALAHAKYAELIPDLLHVH 240
           IGHTLGSYEEGVAALEAGASSFTHLYNAMSPLHHREPGIVGAALAHAKYAELIPDLLHVH
Sbjct: 181 IGHTLGSYEEGVAALEAGASSFTHLYNAMSPLHHREPGIVGAALAHAKYAELIPDLLHVH 240

Query: 241 PGAIRVALRSIPCLYCVTDSTAAAGMPDGEYKLGSHTVTKCLGGVRLPDGTLAGSTLTMD 300
           PGAIRVALRSIPCLYCVTDSTAAAGMPDGEYKLGSHTVTKCLGGVRLPDGTLAGSTLTMD
Sbjct: 241 PGAIRVALRSIPCLYCVTDSTAAAGMPDGEYKLGSHTVTKCLGGVRLPDGTLAGSTLTMD 300

Query: 301 QALRNLVKIGLPLAEASQRLSQFPADYLGIQERGRLQPGAWADCVRLDRSLTLTAVMVEG 360
           QALRNLVKIGLPLAEASQRLSQFPADYLGIQERGRLQPGAWADCVRLDRSLTLTAVMVEG
Sbjct: 301 QALRNLVKIGLPLAEASQRLSQFPADYLGIQERGRLQPGAWADCVRLDRSLTLTAVMVEG 360

Query: 361 EDIDFKNA 368
           EDIDFKNA
Sbjct: 361 EDIDFKNA 368


Lambda     K      H
   0.320    0.138    0.416 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 716
Number of extensions: 19
Number of successful extensions: 1
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 368
Length of database: 368
Length adjustment: 30
Effective length of query: 338
Effective length of database: 338
Effective search space:   114244
Effective search space used:   114244
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 49 (23.5 bits)

Align candidate AO353_04450 AO353_04450 (N-acetylglucosamine-6-phosphate deacetylase)
to HMM TIGR00221 (nagA: N-acetylglucosamine-6-phosphate deacetylase (EC 3.5.1.25))

# hmmsearch :: search profile(s) against a sequence database
# HMMER 3.3.1 (Jul 2020); http://hmmer.org/
# Copyright (C) 2020 Howard Hughes Medical Institute.
# Freely distributed under the BSD open source license.
# - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
# query HMM file:                  ../tmp/path.carbon/TIGR00221.hmm
# target sequence database:        /tmp/gapView.12677.genome.faa
# - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query:       TIGR00221  [M=380]
Accession:   TIGR00221
Description: nagA: N-acetylglucosamine-6-phosphate deacetylase
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence                                     Description
    ------- ------ -----    ------- ------ -----   ---- --  --------                                     -----------
    1.1e-79  254.1   0.0    1.3e-79  253.8   0.0    1.0  1  lcl|FitnessBrowser__pseudo3_N2E3:AO353_04450  AO353_04450 N-acetylglucosamine-


Domain annotation for each sequence (and alignments):
>> lcl|FitnessBrowser__pseudo3_N2E3:AO353_04450  AO353_04450 N-acetylglucosamine-6-phosphate deacetylase
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  253.8   0.0   1.3e-79   1.3e-79      52     379 ..      40     360 ..      15     361 .. 0.94

  Alignments for each domain:
  == domain 1  score: 253.8 bits;  conditional E-value: 1.3e-79
                                     TIGR00221  52 nvltpGliDvqlnGcgGvdtndasvetleimsealaksGvtsfLptlitredeeikkavkvarey 116
                                                    +l+pG+iD++++G+gG d+++ +  +++ + ++  + G+ts L+t++t++ eei++ +  + e+
  lcl|FitnessBrowser__pseudo3_N2E3:AO353_04450  40 PYLLPGFIDLHVHGGGGKDIMEGT-PAFDTITKTHVRFGTTSLLATTMTAPPEEISRVLAEVGEF 103
                                                   589******************854.67788889999***************************** PP

                                     TIGR00221 117 lakekn..akiLGlhleGPflslekkGahpkeyirepdvellkkfldeagdvitkvtlapeekqt 179
                                                     + +   a++LG+hleGP++++ k Ga+p ++ + + ++ ++ +l  a   i+ +t+ape  ++
  lcl|FitnessBrowser__pseudo3_N2E3:AO353_04450 104 CEQRPKgcARVLGVHLEGPYINPGKLGAQP-NFAHTALMAEVEAYLALA--PIRVITIAPEIAGH 165
                                                   *9998879********************86.788887666658888766..6************* PP

                                     TIGR00221 180 aelisklleagiivsaGhtnatyeelkeafkaGitfathlynamskldhRepgviGavLdeddvv 244
                                                    +li+ l + gi +++Ght   yee  +a +aG++  thlynams+l+hRepg++Ga+L++   +
  lcl|FitnessBrowser__pseudo3_N2E3:AO353_04450 166 DKLIRALSDRGIRMQIGHTLGSYEEGVAALEAGASSFTHLYNAMSPLHHREPGIVGAALAH-AKY 229
                                                   *************************************************************.679 PP

                                     TIGR00221 245 teiiaDGlhihpknirlakklkgdsklvlvtDslaaagaklekfifaGkevyiredtlldkngtl 309
                                                   +e+i D lh+hp +ir+a +   +  l  vtDs+aaag++++++  + ++v+   +++   +gtl
  lcl|FitnessBrowser__pseudo3_N2E3:AO353_04450 230 AELIPDLLHVHPGAIRVALR--SIPCLYCVTDSTAAAGMPDGEYKLGSHTVTKCLGGVRLPDGTL 292
                                                   ****************9966..5566*************************************** PP

                                     TIGR00221 310 aGssltmiegvknlvefveislsdvvrisslnparalgiddrlGsvakGkdanLavltkdfevil 374
                                                   aGs+ltm ++++nlv  + ++l+++ +  s++pa  lgi++r G ++ G  a+ + l++   ++ 
  lcl|FitnessBrowser__pseudo3_N2E3:AO353_04450 293 AGSTLTMDQALRNLVKIG-LPLAEASQRLSQFPADYLGIQER-GRLQPGAWADCVRLDRSLTLTA 355
                                                   ****************99.***********************.********************** PP

                                     TIGR00221 375 tiveg 379
                                                    +veg
  lcl|FitnessBrowser__pseudo3_N2E3:AO353_04450 356 VMVEG 360
                                                   ***98 PP



Internal pipeline statistics summary:
-------------------------------------
Query model(s):                            1  (380 nodes)
Target sequences:                          1  (368 residues searched)
Passed MSV filter:                         1  (1); expected 0.0 (0.02)
Passed bias filter:                        1  (1); expected 0.0 (0.02)
Passed Vit filter:                         1  (1); expected 0.0 (0.001)
Passed Fwd filter:                         1  (1); expected 0.0 (1e-05)
Initial search space (Z):                  1  [actual number of targets]
Domain search space  (domZ):               1  [number of targets reported over threshold]
# CPU time: 0.01u 0.01s 00:00:00.02 Elapsed: 00:00:00.01
# Mc/sec: 7.52
//
[ok]

This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer. Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, or view the source code.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory