Align IIC' aka PtsC2, component of N-Acetylglucosamine (NAG) porter (PtsBC1C2)(also may facilitate xylose transport) (characterized)
to candidate AO353_04465 AO353_04465 PTS N-acetyl-D-glucosamine transporter
Query= TCDB::Q8GBT6 (403 letters) >FitnessBrowser__pseudo3_N2E3:AO353_04465 Length = 571 Score = 372 bits (956), Expect = e-107 Identities = 187/392 (47%), Positives = 260/392 (66%), Gaps = 36/392 (9%) Query: 4 LQRIGRSLMLPVAVLPAAALLVRLGNADMLGRPEFPAFVTKIAGFMAAGGNAILDNMALL 63 LQR+GR+LMLP+A+LP A LL+RLG+ D+L + G I N+AL+ Sbjct: 9 LQRLGRALMLPIAILPIAGLLLRLGDTDLLN-----------IAIIHDAGQVIFANLALI 57 Query: 64 FAVGIAIGFAKKSDGSTALAAVVGYLVFKNVLATFTDKNLPQVAKAVDGKVVMVDAPVDA 123 FA+GIA+GFA+ ++G+ LA +GYLV + L ++DA ++ Sbjct: 58 FAIGIAVGFARDNNGTAGLAGAIGYLVMVSTLK-------------------VLDASINM 98 Query: 124 KVLGGVVMGLVVALLYQRFYRTKLPDWAGFFGGRRLVPILSAFAGLVIGIVFGYIWPVLG 183 +L G++ GL+ LY RF KLP++ FFGGRR VPI + F+ + +G++FG IWP + Sbjct: 99 GMLAGIISGLMAGALYNRFKDIKLPEYLAFFGGRRFVPIATGFSAVGLGVIFGLIWPPIQ 158 Query: 184 TGLHNFGEWLVGSGAVGAGIFGVANRALIPIGMHHLLNSFPWFQAGEYEGKS------GD 237 G+++FG+ L+ SG++GA +FGV NR LI G+HH+LN+ WF G + + GD Sbjct: 159 HGINSFGQLLLESGSIGAFVFGVFNRLLIVTGLHHILNNMAWFIFGSFTDPTTGAIVTGD 218 Query: 238 IARFLAGDPTAGQFMTGFFPIMMFALPAACLAIVHCARPERRKVVGGMMFSLALTSFVTG 297 +AR+ AGDP GQFMTG FP+M+F LPAACLA+ A PERRKV+GG+ S+ALTSF+TG Sbjct: 219 LARYFAGDPKGGQFMTGMFPMMIFGLPAACLAMYRNALPERRKVMGGIFLSMALTSFLTG 278 Query: 298 VTEPIEFTFMFIAPVLYAIHAVLTGVSMALTWALGMKDGFGFSAGAVDFFLNLGIASNPW 357 VTEPIEF FMF+AP+LY +H +LTG++MA+T AL + GF FS GA+D L G ++N W Sbjct: 279 VTEPIEFAFMFLAPLLYLLHVLLTGMAMAITNALNIHLGFTFSGGAIDMALGWGKSTNGW 338 Query: 358 GLALVGVCFAALYYVVFRFAITKFNLPTPGRE 389 + VG+ +A +YYVVF F I +FNL TPGRE Sbjct: 339 LVFPVGLAYAVIYYVVFDFCIRRFNLKTPGRE 370 Lambda K H 0.328 0.143 0.441 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 744 Number of extensions: 54 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 403 Length of database: 571 Length adjustment: 34 Effective length of query: 369 Effective length of database: 537 Effective search space: 198153 Effective search space used: 198153 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.7 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory