Align lactaldehyde dehydrogenase (EC 1.2.1.22); D-glyceraldehyde dehydrogenase (NADP+) (EC 1.2.1.89) (characterized)
to candidate AO353_28230 AO353_28230 succinate-semialdehyde dehydrogenase
Query= BRENDA::P25553 (479 letters) >FitnessBrowser__pseudo3_N2E3:AO353_28230 Length = 485 Score = 345 bits (886), Expect = 2e-99 Identities = 184/468 (39%), Positives = 283/468 (60%), Gaps = 2/468 (0%) Query: 10 YIDGQFVTWRGDAWIDVVNPATEAVISRIPDGQAEDARKAIDAAERAQPEWEALPAIERA 69 YIDGQ++ A +DV++PA +++R+P Q + R+AIDAAE+A P W A PA ERA Sbjct: 17 YIDGQWIGADNAATLDVIDPANGQLLARVPAMQGTETRRAIDAAEKAWPAWRARPAAERA 76 Query: 70 SWLRKISAGIRERASEISALIVEEGGKIQQLAEVEVAFTADYIDYMAEWARRYEGEIIQS 129 + L + + + +++ ++ E GK A+ E+ + A ++ + AE ARR GE I + Sbjct: 77 ALLERWYQAMIDNLDDLALIMTCEQGKPLNEAKGEIRYGAGFVKWFAEEARRVYGETIPA 136 Query: 130 DRPGENILLFKRALGVTTGILPWNFPFFLIARKMAPALLTGNTIVIKPSEFTPNNAIAFA 189 +L K+ +GV I PWNFP +I RK APAL G I++KPS+ TP +A+A A Sbjct: 137 PSGDRRLLTLKQPVGVCAAITPWNFPNAMITRKCAPALAAGCPIIVKPSDLTPLSALALA 196 Query: 190 KIVDEIGLPRGVFNLVLGRGETVGQELAGNPKVAMVSMTGSVSAGEKIMATAAKNITKVC 249 + + +G+P GVFN++ G +G+EL GNP V +S TGS + G +M +A++I ++ Sbjct: 197 VLAERVGIPAGVFNVLTGMPAGIGEELTGNPSVRKISFTGSTAVGRLLMRQSAEHIKRLS 256 Query: 250 LELGGKAPAIVMDDADLELAVKAIVDSRVINSGQVCNCAERVYVQKGIYDQFVNRLGEAM 309 LELGG AP IV DDADLE AV I+ S+ N+GQ C CA R+ VQ GIY++F RL E + Sbjct: 257 LELGGNAPFIVFDDADLEQAVAGIMLSKFRNAGQTCVCANRILVQDGIYERFAQRLVEEV 316 Query: 310 QAVQFGNPAERNDIAMGPLINAAALERVEQKVARAVEEGARVAFGGKAVEGKGYYYPPTL 369 ++ GN + D+ +GPLIN AA+ +V + + A+ +GAR+ GG EG + PT+ Sbjct: 317 GKLKVGNGLDA-DVTIGPLINPAAVSKVARHIDDALSQGARLLCGG-IPEGDSQFVQPTV 374 Query: 370 LLDVRQEMSIMHEETFGPVLPVVAFDTLEDAISMANDSDYGLTSSIYTQNLNVAMKAIKG 429 L D M + +EETFGPV P++ F +A+++AN + YGL + +TQ+L + + + Sbjct: 375 LGDAHAGMLLANEETFGPVAPLMRFTEEAEALALANATPYGLGAYYFTQDLRRSWRFGEA 434 Query: 430 LKFGETYINRENFEAMQGFHAGWRKSGIGGADGKHGLHEYLQTQVVYL 477 L+FG +N G ++SG+G K+GL EYL+ + ++ Sbjct: 435 LEFGMVGLNTGIISMEVAPFGGIKQSGLGREGSKYGLDEYLEVKAFHI 482 Lambda K H 0.318 0.135 0.392 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 584 Number of extensions: 30 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 479 Length of database: 485 Length adjustment: 34 Effective length of query: 445 Effective length of database: 451 Effective search space: 200695 Effective search space used: 200695 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 52 (24.6 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory