Align AraV, component of Arabinose, fructose, xylose porter (characterized)
to candidate AO353_25895 AO353_25895 ABC transporter ATP-binding protein
Query= TCDB::Q97UF2 (371 letters) >FitnessBrowser__pseudo3_N2E3:AO353_25895 Length = 367 Score = 196 bits (497), Expect = 1e-54 Identities = 113/300 (37%), Positives = 178/300 (59%), Gaps = 19/300 (6%) Query: 1 MTTIRVENLSKIFKKGKTEVKAVDNVSITIDSGMAFGVLGPSGHGKTTFLRLIAGLEEPT 60 M ++++NL K F+ G + +K +D + ++ +GPSG GK+T LRLIAGLEE T Sbjct: 1 MAHLKIKNLQKGFE-GFSIIKGID---LEVNDREFVVFVGPSGCGKSTLLRLIAGLEEVT 56 Query: 61 SGYIYFDNEAVSSPRRVMMSPEKRGIAMVFQNWALYPNMTVFDNIAFPLKLAKVPKDKIE 120 +G I D ++ +SP KR +AMVFQ +ALYP+M+V N++F L LA V K ++E Sbjct: 57 AGTIELDGRDITE-----VSPAKRDLAMVFQTYALYPHMSVRKNMSFALDLAGVNKAEVE 111 Query: 121 NKVKEVSEELGLSGVLNRYPKELSGGQMQRTAIARALVKDPKVLLLDEPFSNLDAQIRES 180 KV E + L L +L R PK+LSGGQ QR AI RA+V++PK+ L DEP SNLDA +R Sbjct: 112 KKVNEAARILELGPMLERKPKQLSGGQRQRVAIGRAIVRNPKIFLFDEPLSNLDAALRVQ 171 Query: 181 ARALVRKIQRERKLTTLIVSHDPADIFAIANKAGVIVNGKFAQIGTPTEIYEYPATDLIA 240 R + ++ +E + T + V+HD + +A+K V+ G+ Q+G+P E+Y PA +A Sbjct: 172 MRLELARLHKELQATMIYVTHDQVEAMTLADKVVVLNGGRIEQVGSPLELYHQPANLFVA 231 Query: 241 RLTG--EINLIQAKII----ENNAII----ANLKVPLNNMELKGQSNIVIGLRPDDLTLS 290 G ++ ++ K+ +N ++ + +PL+ L + +G+RP+ L L+ Sbjct: 232 GFLGTPKMGFLKGKVTRVERQNCEVLLDAGTRITLPLSGANLSIGGAVTLGIRPEHLNLA 291 Lambda K H 0.317 0.136 0.374 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 297 Number of extensions: 16 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 371 Length of database: 367 Length adjustment: 30 Effective length of query: 341 Effective length of database: 337 Effective search space: 114917 Effective search space used: 114917 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory