Align Inner-membrane translocator (characterized, see rationale)
to candidate AO353_20825 AO353_20825 ABC transporter permease
Query= uniprot:A0KWY6 (405 letters) >FitnessBrowser__pseudo3_N2E3:AO353_20825 Length = 325 Score = 135 bits (340), Expect = 2e-36 Identities = 95/320 (29%), Positives = 160/320 (50%), Gaps = 6/320 (1%) Query: 53 AGKSTSMGRYLWPLLALSILLLANLFIDSSFFNISYQDDRLYGSLIDILNRSAPVALLSI 112 AGK +S L L L+ LLA + + F++ Y + + N+ + +L++ Sbjct: 7 AGKRSSNFYGLGTYLGLAGALLAMI----ALFSVLSSHFLSYDTFSTLANQIPDLMVLAV 62 Query: 113 GMSLVIATGGIDLSVGAVMAIAGAVCANLLLVPDISLVTVIAAGLIVGLLAGCINGGLVS 172 GM+ V+ GGIDLSVG+V+A+AG+ + +L S++ G+ +AG I G + Sbjct: 63 GMTFVLIIGGIDLSVGSVLALAGSTVSVAILGWGWSVLPAALLGMAAAAVAGTITGSITV 122 Query: 173 FLGIQPIVATLLLMVAGRGVAQLINQGQIITFQHPGFAAIGVGQFLGLPMPVWIVIGMLT 232 I + +L ++ RGVA + G + FA + G+ I + ++ Sbjct: 123 AWRIPSFIVSLGVLEMARGVAYQMT-GSRTAYIGDAFAWLSNPITFGISPSFIIALLVIF 181 Query: 233 FSQLLLRKTALGLFIEAVGCNAKASRYLGINDKSIKLFAYGIAGLCAALAGMISTADIQG 292 +Q +L +T G ++ +G N +A R GIN K K+ + + GL A +A + + ++ Sbjct: 182 IAQAVLTRTVFGRYLIGIGTNEEAVRLAGINPKPYKILVFSLMGLLAGIAALFQISRLEA 241 Query: 293 SDANNAGLWLELDAVLAVVIGGAALTGGRFSLILSVVGALIIQTLATTIIVSGLPAKFNL 352 +D NAG LEL + AVVIGG +L GGR S+I + G LII LA + G Sbjct: 242 ADP-NAGSGLELQVIAAVVIGGTSLMGGRGSVISTFFGVLIISVLAAGLAQIGATEPTKR 300 Query: 353 LIKAIVILTVLLLQSAKFRR 372 +I VI+ ++L + + +R Sbjct: 301 IITGAVIVVAVVLDTYRSQR 320 Lambda K H 0.323 0.136 0.379 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 313 Number of extensions: 15 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 405 Length of database: 325 Length adjustment: 29 Effective length of query: 376 Effective length of database: 296 Effective search space: 111296 Effective search space used: 111296 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (22.0 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory