Align Carbamate kinase; EC 2.7.2.2 (characterized, see rationale)
to candidate AO353_03480 AO353_03480 carbamate kinase
Query= uniprot:P13982 (310 letters) >FitnessBrowser__pseudo3_N2E3:AO353_03480 Length = 309 Score = 505 bits (1300), Expect = e-148 Identities = 247/309 (79%), Positives = 285/309 (92%), Gaps = 1/309 (0%) Query: 1 MRIVVALGGNALLRRGEPMTADNQRENVRIAAEQIAKVAPGNELVIAHGNGPQVGLLALQ 60 MRIV+ALGGNALLRRGEPMTADNQR N+R+A EQIAK+ PGN+LVIAHGNGPQ+GLL+LQ Sbjct: 1 MRIVIALGGNALLRRGEPMTADNQRGNIRVATEQIAKIHPGNQLVIAHGNGPQIGLLSLQ 60 Query: 61 GAAYDKVSPYPLDVLGAETEGMIGYMIEQEMGNLLPFEVPFATILTQVEVDGKDPAFQNP 120 AAY VSPYPLDVLGAET+GMIGY+IEQE+GNLL FEVPFAT+LTQVEVD DPAFQ+P Sbjct: 61 AAAYTSVSPYPLDVLGAETDGMIGYIIEQELGNLLDFEVPFATLLTQVEVDPNDPAFQHP 120 Query: 121 TKPIGPVYSREEAERLAAEKGWSIAPDGDKFRRVVPSPRPKRIFEIRPVKWLLEKGTIVI 180 +KPIGPVYS+ EAE+LAAEKGW+IAPDGDKFRRVV SP+PKRIFEIRPVKWLLEKG+IVI Sbjct: 121 SKPIGPVYSKAEAEKLAAEKGWAIAPDGDKFRRVVASPKPKRIFEIRPVKWLLEKGSIVI 180 Query: 181 CAGGGGIPTMYDEAGKKLSGVEAVIDKDLCSSLLAQELVADILIIATDVDAAYVDWGKPT 240 CAGGGGIPTMYDE +KL GVEAVIDKDLCS+LLA++L +D+L+IATDV+AA++D+GKPT Sbjct: 181 CAGGGGIPTMYDE-HRKLKGVEAVIDKDLCSALLAEQLESDLLVIATDVNAAFIDFGKPT 239 Query: 241 QKAIAQAHPDELERLGFAAGSMGPKVQAAIEFARATGKDAVIGSLADIVAITEGKAGTRV 300 QKAIA+AHPD++E+L FAAGSMGPKVQAA EFAR TGK AVIGSL+DI AI +G+AGTR+ Sbjct: 240 QKAIARAHPDDIEKLDFAAGSMGPKVQAACEFARNTGKVAVIGSLSDIEAIVQGRAGTRI 299 Query: 301 STRKAGIEY 309 ST + GI Y Sbjct: 300 STAEPGITY 308 Lambda K H 0.317 0.136 0.393 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 402 Number of extensions: 15 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 310 Length of database: 309 Length adjustment: 27 Effective length of query: 283 Effective length of database: 282 Effective search space: 79806 Effective search space used: 79806 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 48 (23.1 bits)
Align candidate AO353_03480 AO353_03480 (carbamate kinase)
to HMM TIGR00746 (arcC: carbamate kinase (EC 2.7.2.2))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.carbon/TIGR00746.hmm # target sequence database: /tmp/gapView.32604.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR00746 [M=309] Accession: TIGR00746 Description: arcC: carbamate kinase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2.2e-131 423.5 0.0 2.5e-131 423.3 0.0 1.0 1 lcl|FitnessBrowser__pseudo3_N2E3:AO353_03480 AO353_03480 carbamate kinase Domain annotation for each sequence (and alignments): >> lcl|FitnessBrowser__pseudo3_N2E3:AO353_03480 AO353_03480 carbamate kinase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 423.3 0.0 2.5e-131 2.5e-131 1 308 [. 1 300 [. 1 301 [. 0.99 Alignments for each domain: == domain 1 score: 423.3 bits; conditional E-value: 2.5e-131 TIGR00746 1 kkvvvaLGGnallqrgekasaeeqrknvekaakqlvklakrgyelvithGngPqvGalllqneaa 65 +++v+aLGGnall+rge ++a++qr n++ a++q++k++ g++lvi+hGngPq+G l lq +a+ lcl|FitnessBrowser__pseudo3_N2E3:AO353_03480 1 MRIVIALGGNALLRRGEPMTADNQRGNIRVATEQIAKIHP-GNQLVIAHGNGPQIGLLSLQAAAY 64 589*************************************.************************ PP TIGR00746 66 dsvpakPldvlgaesqgliGYllqqalkeelakeglekkvatvltqvivdekDeaFqnPtkpigp 130 sv+++Pldvlgae++g+iGY+++q+l + l +e ++at+ltqv+vd++D+aFq+P kpigp lcl|FitnessBrowser__pseudo3_N2E3:AO353_03480 65 TSVSPYPLDVLGAETDGMIGYIIEQELGNLLD---FEVPFATLLTQVEVDPNDPAFQHPSKPIGP 126 *******************************9...****************************** PP TIGR00746 131 fydeeeakrlaaekgailkedagrgwRrvvpsPkPkeiveaeviktLvekgvivissgGGGvPvv 195 +y+++ea++laaekg+ ++ +g+++Rrvv+sPkPk+i+e++ +k+L+ekg ivi++gGGG+P++ lcl|FitnessBrowser__pseudo3_N2E3:AO353_03480 127 VYSKAEAEKLAAEKGWAIAP-DGDKFRRVVASPKPKRIFEIRPVKWLLEKGSIVICAGGGGIPTM 190 ********************.9******************************************* PP TIGR00746 196 kdgke.lkGveaviDkDlasekLaeevnaDilviltdvdavyvnygkpdekkleevkveeleela 259 +d+++ lkGveaviDkDl+s++Lae++++D lvi+tdv+a+++++gkp++k++++++++++e+l lcl|FitnessBrowser__pseudo3_N2E3:AO353_03480 191 YDEHRkLKGVEAVIDKDLCSALLAEQLESDLLVIATDVNAAFIDFGKPTQKAIARAHPDDIEKLD 255 988755**********************************************************9 PP TIGR00746 260 kdgefaaGsmgPkveaaiefvesrgkkaiitslekivealegkaGtvvv 308 faaGsmgPkv+aa ef++++gk a+i+sl++i+++++g aGt+++ lcl|FitnessBrowser__pseudo3_N2E3:AO353_03480 256 ----FAAGSMGPKVQAACEFARNTGKVAVIGSLSDIEAIVQGRAGTRIS 300 ....*******************************************97 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (309 nodes) Target sequences: 1 (309 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.01s 00:00:00.02 Elapsed: 00:00:00.01 # Mc/sec: 6.49 // [ok]
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory