Align AotP aka AotM aka PA0890, component of Arginine/ornithine (but not lysine) porter (characterized)
to candidate AO353_27980 AO353_27980 amino acid ABC transporter permease
Query= TCDB::O50183 (232 letters) >FitnessBrowser__pseudo3_N2E3:AO353_27980 Length = 231 Score = 388 bits (996), Expect = e-113 Identities = 191/230 (83%), Positives = 216/230 (93%) Query: 2 IFDFSVIWDSLPLYFDGLLVTLKLLSISLLIGLLLAVPLALMRVSKQPLVNFPAWLYTYV 61 + D+++IW++LPLYF G L+TLK+L ISL GL+LA+PLALMRVS+ PL+NFPAWLYTY Sbjct: 1 MLDYNLIWENLPLYFSGALLTLKVLLISLAFGLMLAIPLALMRVSRSPLINFPAWLYTYA 60 Query: 62 IRGTPMLVQLFLIYYGLAQFDAVRESALWPWLSNASFCACLAFAINTSAYTAEILAGSLK 121 IRGTPMLVQLFLIYYGLAQF+AVR+S LWP+LS+A+FCACLAFAINTSAY+AE+LAGSLK Sbjct: 61 IRGTPMLVQLFLIYYGLAQFEAVRQSVLWPYLSSATFCACLAFAINTSAYSAELLAGSLK 120 Query: 122 ATPHGEIEAAKAMGMSRLKMYRRILLPSALRRALPQYSNEVIMMLQTTSLASIVTLVDIT 181 +TP+GEIEAAKAMGMSRL +YRRILLPSALRRALPQYSNEV+MMLQTTSLASIVTLVDIT Sbjct: 121 STPNGEIEAAKAMGMSRLTLYRRILLPSALRRALPQYSNEVLMMLQTTSLASIVTLVDIT 180 Query: 182 GAARTVYSQYYLPFEAFITAGLFYLCLTFILVRLFKLAERRWLAYLAPRK 231 GAARTV S++YLPFEAFITAGL YL LTFILVRLFKLAER WLAYLAPRK Sbjct: 181 GAARTVSSRFYLPFEAFITAGLIYLALTFILVRLFKLAERHWLAYLAPRK 230 Lambda K H 0.330 0.140 0.425 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 236 Number of extensions: 3 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 232 Length of database: 231 Length adjustment: 23 Effective length of query: 209 Effective length of database: 208 Effective search space: 43472 Effective search space used: 43472 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.9 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory