Align Transmembrane component of a broad range amino acid ABC transporter (characterized, see rationale)
to candidate AO353_17115 AO353_17115 leucine/isoleucine/valine transporter permease subunit
Query= uniprot:Q1MCU1 (463 letters) >FitnessBrowser__pseudo3_N2E3:AO353_17115 Length = 418 Score = 357 bits (917), Expect = e-103 Identities = 212/439 (48%), Positives = 284/439 (64%), Gaps = 30/439 (6%) Query: 18 KGLTEALFAAVLSFGMFVLYVGLKTDQNISNELIIVQRWGLLAIFVAVAAIGRFAMVVFI 77 + L +ALF+A+L + + +GLK +I+ + VQ + + A ++++F+ Sbjct: 3 RNLRQALFSALLVWAVAYPVLGLKL--SIAGINLEVQGATTSTLLIIAAC----SVLMFL 56 Query: 78 RPNIDRRKLSKAR---EGELDISTEKSFFHRHFLKIALIALLLYPMVVVAIKGPQGSLTY 134 R DR + R +G+L ++ +F + +I L+ +V G +G++ Sbjct: 57 RVLFDREYTAAMRSVPKGKLIPASASNFLTLPSTQRWVIMGLIVIALVWPFFGSRGAV-- 114 Query: 135 VDNFGIQILIYVMLAWGLNIVVGLAGLLDLGYVAFYAVGAYSYALLSSYFGLSFWVLLPL 194 + ILIYV+L GLNIVVGLAGLLDLGYV FYAVGAYSYALLS Y+GLSFW+ LP+ Sbjct: 115 --DIATLILIYVLLGLGLNIVVGLAGLLDLGYVGFYAVGAYSYALLSHYYGLSFWICLPI 172 Query: 195 SGIFAALWGVILGFPVLRLRGDYLAIVTLAFGEIIRLVLINWTDVTKGTFGISSIPKATL 254 +G+ AA +G +LGFPVLRLRGDYLAIVTL FGEIIRL L N T +T G GIS+IPK +L Sbjct: 173 AGLMAATFGFLLGFPVLRLRGDYLAIVTLGFGEIIRLFLRNLTGLTGGPNGISNIPKPSL 232 Query: 255 FGIPFDATAGGFAKLFH----LPISSAYYKIFLFYLILALCMLTAYVTIRLRRMPIGRAW 310 FG+ F+ TA + FH L + +FL+ + L L + +V RL RMPIGRAW Sbjct: 233 FGLSFERTAAEGMQTFHEFFGLTYNPVSKVVFLYLVALLLALFALFVINRLLRMPIGRAW 292 Query: 311 EALREDEIACRSLGINTVTTKLTAFATGAMFAGFAGSFFAARQGFVSPESFVFLESAVIL 370 EALREDEIACR+LG+N KL+AF GA FAGFAGSFFAARQG V+PESF F+ESA IL Sbjct: 293 EALREDEIACRALGLNPTVIKLSAFTLGACFAGFAGSFFAARQGLVTPESFTFIESATIL 352 Query: 371 AIVVLGGMGSLTGIAIAAIVMVGGTELLREMSFLKLIFGPDFTPELYRMLIFGLAMVVVM 430 AIVVLGGMGS G+ +AA+VM+ EL+R+ S YRML+FG MV++M Sbjct: 353 AIVVLGGMGSQLGVVLAAVVMILLPELMRDFS-------------EYRMLMFGALMVLMM 399 Query: 431 LFKPRGFVGSREPTAFLRE 449 +++P+G + + P LR+ Sbjct: 400 IWRPQGLLPMQRPHMELRK 418 Lambda K H 0.330 0.145 0.432 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 635 Number of extensions: 38 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 463 Length of database: 418 Length adjustment: 32 Effective length of query: 431 Effective length of database: 386 Effective search space: 166366 Effective search space used: 166366 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.8 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory