Align Enoyl-CoA hydratase [valine degradation] (EC 4.2.1.17) (characterized)
to candidate AO353_03780 AO353_03780 enoyl-CoA hydratase
Query= reanno::psRCH2:GFF2389 (257 letters) >FitnessBrowser__pseudo3_N2E3:AO353_03780 Length = 249 Score = 115 bits (287), Expect = 1e-30 Identities = 80/252 (31%), Positives = 122/252 (48%), Gaps = 23/252 (9%) Query: 6 LLVDIQERVALITLNRPQALNALNGQLISELNQALGQLEADPQIGCIVLTGSAKAFAAGA 65 +L++ + + + LNRP NAL + S+L AL Q +ADP+I I++TG+ + F AG Sbjct: 5 ILLERERGLLTLRLNRPDKKNALTRAMYSQLADALLQADADPEINAILITGTRECFTAGN 64 Query: 66 DIKEMAELTYPQIYLDDFFADADRIATRRKPLIAAVAGYALGGGCELALLCDMIFAADNA 125 DI + E P F + RKP+IAAVAG A+G G L L CD+++ + +A Sbjct: 65 DIADFLEEP-PSDLTSPVFQFMRNLLECRKPVIAAVAGAAVGIGTTLLLHCDLVYISADA 123 Query: 126 RFGQPEVNLGVLPGIGGTQRLTRAVGKAKAMDMCLTGRQMDAAEAERAGLVARVFPAESL 185 + P VNLG+ P G + L R +G+AKA ++ L G + +A G+ + P Sbjct: 124 KLRMPFVNLGLCPEFGSSLILPRLLGQAKAAELLLLGEGFNGEQAAAWGIATQALPTG-- 181 Query: 186 LEETLKAARVIAEKSLPATMMIKESVNRAFETTLAEGIRFERRVFHA----VFATADQKE 241 E L AR +A + FET E +R +++ A A ++E Sbjct: 182 -EAALAKAREMALR---------------FETLAPEAVRISKQLMKAPDREQLRKAIEEE 225 Query: 242 GMAAFSEKRKPE 253 G R PE Sbjct: 226 GNLFVQRLRSPE 237 Lambda K H 0.321 0.135 0.375 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 145 Number of extensions: 10 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 257 Length of database: 249 Length adjustment: 24 Effective length of query: 233 Effective length of database: 225 Effective search space: 52425 Effective search space used: 52425 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory