Align 4-aminobutyrate-2-oxoglutarate transaminase (EC 2.6.1.19) (characterized)
to candidate AO353_28215 AO353_28215 4-aminobutyrate aminotransferase
Query= BRENDA::Q0K2K2 (423 letters) >FitnessBrowser__pseudo3_N2E3:AO353_28215 Length = 430 Score = 434 bits (1117), Expect = e-126 Identities = 220/416 (52%), Positives = 287/416 (68%), Gaps = 1/416 (0%) Query: 8 LNQRRTLATPRGVGVMCDFYADRAENATLWDVEGRAYTDFAAGIAVLNTGHRHPRVMQAI 67 L ++R PRG+ DRA+ A LWDV+G+ Y DF GI VLN GH HP+V+ A+ Sbjct: 11 LLRQRDQFVPRGLVTAHPLVIDRAQGAELWDVDGKRYLDFVGGIGVLNIGHNHPKVVAAV 70 Query: 68 AAQLERFTHTAYQIVPYQGYVTLAERINALVPIQGLNKTALFTTGAEAVENAIKIARAHT 127 AQL++ +H +Q+V Y+ Y+ LA+R+ ++ K A FT+GAEAVENA+KIARAHT Sbjct: 71 QAQLQKVSHACFQVVAYKPYLDLAQRLCEMIGGNEAYKAAFFTSGAEAVENAVKIARAHT 130 Query: 128 GRPGVIAFSGAFHGRTLLGMALTGKVAPYKIGFGPFPSDIYHAPFPSALHGVSTERALQA 187 R VIAF G FHGRTLLG LTG PYK FGPF +++H P+P+A GVS+E AL+A Sbjct: 131 NRSAVIAFRGGFHGRTLLGTTLTGMSQPYKQNFGPFAPEVFHTPYPNAYRGVSSEMALKA 190 Query: 188 LEGLFKTDIDPARVAAIIVEPVQGEGGFQAAPADFMRGLRAVCDQHGIVLIADEVQTGFG 247 L+ L T + P RVAAII+EPVQG+GGF +APA+F++ LRA+ ++HGIVLI DE+QTGFG Sbjct: 191 LDELLATQVAPERVAAIIIEPVQGDGGFLSAPAEFLQALRALTEKHGIVLILDEIQTGFG 250 Query: 248 RTGKMFAMSHHDVEPDLITMAKSLAGGMPLSAVSGRAAIMDAPLPGGLGGTYAGNPLAVA 307 RTGK F H ++PDL+T+AKSLAGG+PLS V G+A IMDAPLPGGLGGTY GN L+ A Sbjct: 251 RTGKWFGFQHAGIQPDLVTVAKSLAGGLPLSGVVGKAGIMDAPLPGGLGGTYGGNALSCA 310 Query: 308 AAHAVIDVIEEEKLCERSASLGQQLREHLLAQRKHCPAMAEVRGLGSMVAAEFC-DPATG 366 AA AVID E+E+L R +LG++LR+ LL + + +VRG G M+A E D Sbjct: 311 AALAVIDAYEQEQLLARGDALGERLRQGLLRLQARHRQIGDVRGSGFMLAIELIKDDDAR 370 Query: 367 QPSAEHAKRVQTRALEAGLVLLTCGTYGNVIRFLYPLTIPQAQFDAALAVLTQALA 422 P A+ +R+ A GL+++ CG Y NV+RFL PL + Q D AL +L ALA Sbjct: 371 TPDADLNQRLIDEARAGGLLVIKCGVYRNVLRFLAPLVTTEDQIDEALQILEAALA 426 Lambda K H 0.321 0.136 0.400 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 537 Number of extensions: 19 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 423 Length of database: 430 Length adjustment: 32 Effective length of query: 391 Effective length of database: 398 Effective search space: 155618 Effective search space used: 155618 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 51 (24.3 bits)
Align candidate AO353_28215 AO353_28215 (4-aminobutyrate aminotransferase)
to HMM TIGR00700 (gabT: 4-aminobutyrate transaminase (EC 2.6.1.19))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.carbon/TIGR00700.hmm # target sequence database: /tmp/gapView.29057.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR00700 [M=420] Accession: TIGR00700 Description: GABAtrnsam: 4-aminobutyrate transaminase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 3.8e-164 532.2 0.2 4.3e-164 532.0 0.2 1.0 1 lcl|FitnessBrowser__pseudo3_N2E3:AO353_28215 AO353_28215 4-aminobutyrate amin Domain annotation for each sequence (and alignments): >> lcl|FitnessBrowser__pseudo3_N2E3:AO353_28215 AO353_28215 4-aminobutyrate aminotransferase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 532.0 0.2 4.3e-164 4.3e-164 2 419 .. 14 426 .. 13 427 .. 0.99 Alignments for each domain: == domain 1 score: 532.0 bits; conditional E-value: 4.3e-164 TIGR00700 2 rraaavskGvgvtlrvlaakaegaelkdvdGnrlidlaagiavlnvGhshPkvveavkrqveelt 66 +r+++v++G+ ++ + ++ +a+gael dvdG+r++d+ +gi+vln+Gh+hPkvv+av+ q++++ lcl|FitnessBrowser__pseudo3_N2E3:AO353_28215 14 QRDQFVPRGLVTAHPLVIDRAQGAELWDVDGKRYLDFVGGIGVLNIGHNHPKVVAAVQAQLQKVS 78 79*************************************************************** PP TIGR00700 67 htafqvvpyesyvelaeklnaiaPgsgekkavllnsGaeavenavkiarkytgrpgvvafsrgfh 131 h++fqvv y+ y++la++l+++ g + ka++++sGaeavenavkiar++t+r +v+af +gfh lcl|FitnessBrowser__pseudo3_N2E3:AO353_28215 79 HACFQVVAYKPYLDLAQRLCEMIGGNEAYKAAFFTSGAEAVENAVKIARAHTNRSAVIAFRGGFH 143 ***************************************************************** PP TIGR00700 132 GrtnltmaltakvkPykiGfGPfapevyraPlpydyrdialdkqeslddelaaiealfvadveae 196 Grt l +lt+ ++Pyk fGPfapev+++P+p yr+ ++ + l+a+++l ++v++e lcl|FitnessBrowser__pseudo3_N2E3:AO353_28215 144 GRTLLGTTLTGMSQPYKQNFGPFAPEVFHTPYPNAYRGVSS--EM----ALKALDELLATQVAPE 202 **************************************988..44....466************* PP TIGR00700 197 qvaavvlePvqGeGGfivpakelvaavaslckehgivliadevqtGfartGklfaieheddkPdl 261 +vaa+++ePvqG+GGf ++ e+++a++ l ++hgivli de+qtGf rtGk f +h + +Pdl lcl|FitnessBrowser__pseudo3_N2E3:AO353_28215 203 RVAAIIIEPVQGDGGFLSAPAEFLQALRALTEKHGIVLILDEIQTGFGRTGKWFGFQHAGIQPDL 267 ***************************************************************** PP TIGR00700 262 itvaksladGlPlsgvvGraeildapapGglGGtyaGnPlavaaalavldiieeeglieraeqig 326 +tvaksla+GlPlsgvvG+a i+dap pGglGGty+Gn l++aaalav+d e+e l r + +g lcl|FitnessBrowser__pseudo3_N2E3:AO353_28215 268 VTVAKSLAGGLPLSGVVGKAGIMDAPLPGGLGGTYGGNALSCAAALAVIDAYEQEQLLARGDALG 332 ***************************************************************** PP TIGR00700 327 klvkdklielkeevpaigdvrglGamiavelv.dpdttePdaalaekiaaaalaaGlllltaGif 390 +++++ l+ l++ +igdvrg G m+a+el+ d d++ Pda l +++ +a+a Gll++ +G++ lcl|FitnessBrowser__pseudo3_N2E3:AO353_28215 333 ERLRQGLLRLQARHRQIGDVRGSGFMLAIELIkDDDARTPDADLNQRLIDEARAGGLLVIKCGVY 397 ******************************998999***************************** PP TIGR00700 391 GniirlltPltisdelldeglkileaala 419 n++r+l+Pl+ +++++de+l+ileaala lcl|FitnessBrowser__pseudo3_N2E3:AO353_28215 398 RNVLRFLAPLVTTEDQIDEALQILEAALA 426 **************************997 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (420 nodes) Target sequences: 1 (430 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.02u 0.01s 00:00:00.03 Elapsed: 00:00:00.02 # Mc/sec: 6.94 // [ok]
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the paper from 2022 on GapMind for carbon sources, or view the source code.
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory