GapMind for catabolism of small carbon sources

 

Aligments for a candidate for patD in Pseudomonas fluorescens FW300-N2E3

Align 4-(gamma-glutamylamino)butanal dehydrogenase (EC 1.2.1.99) (characterized)
to candidate AO353_15035 AO353_15035 aldehyde dehydrogenase

Query= BRENDA::P23883
         (495 letters)



>lcl|FitnessBrowser__pseudo3_N2E3:AO353_15035 AO353_15035 aldehyde
           dehydrogenase
          Length = 496

 Score =  508 bits (1308), Expect = e-148
 Identities = 255/492 (51%), Positives = 339/492 (68%), Gaps = 4/492 (0%)

Query: 6   LAYWQDKALSLAIENRLFINGEYTAAAENETFETVDPVTQAPLAKIARGKSVDIDRAMSA 65
           L YWQ +A +L    +  I G+   A   +TF  ++P T A LA++A   + D+D A+ +
Sbjct: 4   LEYWQGQAAALQFPTQALIEGKQRPAQSGQTFAAINPATGAVLAEVAACGNADVDAAVIS 63

Query: 66  ARGVFERGDWSLSSPAKRKAVLNKLADLMEAHAEELALLETLDTGKPIRHSLRDDIPGAA 125
           AR  FE G WS  SP +RK VL +LA+L+ A+ EELALL++L+ GKP+  +   D+PGAA
Sbjct: 64  ARQAFESGVWSARSPGERKQVLLRLAELIMANREELALLDSLNMGKPVMDAYTIDVPGAA 123

Query: 126 RAIRWYAEAIDKVYGEVATTSSHELAMIVREPVGVIAAIVPWNFPLLLTCWKLGPALAAG 185
              RWYAE++DK+Y ++A ++ + LA I RE +GV+AA+VPWNFPL +  WKL PALAAG
Sbjct: 124 GVFRWYAESLDKLYDQIAPSAQNVLATITREALGVVAAVVPWNFPLDMAAWKLAPALAAG 183

Query: 186 NSVILKPSEKSPLSAIRLAGLAKEAGLPDGVLNVVTGFGHEAGQALSRHNDIDAIAFTGS 245
           NSVILKP+E+SP SA+RL  LA EAG+P GVLNV+ G G +AG+AL  H DID + FTGS
Sbjct: 184 NSVILKPAEQSPFSALRLGELALEAGVPPGVLNVLPGLGEQAGKALGLHLDIDCLVFTGS 243

Query: 246 TRTGKQLLKDAGDSNMKRVWLEAGGKSANIVFADCPDLQQAASATAAGIFYNQGQVCIAG 305
           T  GK  ++ +  SN+K+VWLE GGKSAN+VFADC DL  AA   A GIF+NQG+VC A 
Sbjct: 244 TEVGKYFMQYSAQSNLKQVWLECGGKSANLVFADCQDLDLAAQKAAFGIFFNQGEVCSAN 303

Query: 306 TRLLLEESIADEFLALLKQQAQNWQPGHPLDPATTMGTLIDCAHADSVHSFIREGESKGQ 365
           +RLL+E SI DEF+  L  Q + WQPG PLD ++T G ++D      +  FI++ E +G 
Sbjct: 304 SRLLVERSIHDEFVERLMVQVERWQPGDPLDSSSTAGAIVDSRQTARIMKFIQQAERQGA 363

Query: 366 LLLDGRNAGLAAA----IGPTIFVDVDPNASLSREEIFGPVLVVTRFTSEEQALQLANDS 421
             + G    +       I PTIF  V  +  L R+E+FGPVL VT F  E  ALQLANDS
Sbjct: 364 KRVCGGQQSIINGSDNFIQPTIFTGVTADMPLFRDEVFGPVLAVTAFDDEASALQLANDS 423

Query: 422 QYGLGAAVWTRDLSRAHRMSRRLKAGSVFVNNYNDGDMTVPFGGYKQSGNGRDKSLHALE 481
            YGL A++WT DL+RAHR++R+L+AG+V VN+ +  D+TVPFGG KQSG GRD SLH+ +
Sbjct: 424 VYGLAASLWTDDLNRAHRVARQLRAGTVSVNSVDALDVTVPFGGGKQSGFGRDLSLHSFD 483

Query: 482 KFTELKTIWISL 493
           K+T+LKT W  L
Sbjct: 484 KYTQLKTTWFQL 495


Lambda     K      H
   0.317    0.133    0.389 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 609
Number of extensions: 21
Number of successful extensions: 2
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 495
Length of database: 496
Length adjustment: 34
Effective length of query: 461
Effective length of database: 462
Effective search space:   212982
Effective search space used:   212982
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 52 (24.6 bits)

This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer. Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the preprint on GapMind for carbon sources, or view the source code.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory