Align arginine permease (characterized)
to candidate AO353_05965 AO353_05965 aromatic amino acid transporter
Query= CharProtDB::CH_091699 (590 letters) >FitnessBrowser__pseudo3_N2E3:AO353_05965 Length = 466 Score = 260 bits (665), Expect = 8e-74 Identities = 155/438 (35%), Positives = 235/438 (53%), Gaps = 17/438 (3%) Query: 78 EVQNAEVKRELKQRHIGMIALGGTIGTGLFIGLSTPLTNAGPVGALISYLFMGSLAYSVT 137 ++Q +KR LK RHI +IALGG IGTGLF+G + L +AGP ++ Y G +A+ + Sbjct: 5 QLQQGVLKRGLKNRHIQLIALGGAIGTGLFLGSAGVLKSAGP-SMILGYAIAGFIAFLIM 63 Query: 138 QSLGEMATFIPVTSSFTVFSQRFLSPAFGAANGYMYWFSWAITFALELSVVGQVIQFWTY 197 + LGEM PV SF+ F+ + G +G+ YW + + EL+ VG+ +QFW Sbjct: 64 RQLGEMIVEEPVAGSFSHFAHNYWGSFAGFLSGWNYWVLYVLVGMAELTAVGKYVQFWWP 123 Query: 198 KVPLAAWISIFWVIITIMNLFPVKYYGEFEFWVASIKVLAIIGFL-IYCFCMVCGAGVTG 256 +VP ++F+V++ ++N VK +GE EFW A IKV+AIIG + + C+ +V G G Sbjct: 124 EVPTWVSAAVFFVLVNLINTMNVKVFGEMEFWFAIIKVVAIIGMIALGCYMLVSGTGGPQ 183 Query: 257 PVGFRYWRNPGAWGPGIISKDKNEGRFLGWVSSLINAAFTFQGTELVGITAGEAANPRKS 316 W + G + G G + ++ F+F G ELVGITA EA+ PRK Sbjct: 184 ASVSNLWSHGGFFPNGT----------NGLLMAMAFIMFSFGGLELVGITAAEASEPRKV 233 Query: 317 VPRAIKKVVFRILTFYIGSLLFIGLLVPYND--PKLTQSTSYVSTSPFIIAIENSGTKVL 374 +P+AI +VV+R+L FY+G+L + L P++ L S S SPF+ G+ Sbjct: 234 IPKAINQVVYRVLIFYVGALTVLLSLYPWDQLLQTLGASGDAYSGSPFVQIFALIGSNTA 293 Query: 375 PHIFNAVILTTIISAANSNIYVGSRILFGLSKNKLAPKFLSRTTKGGVPYIAVFVTAAFG 434 I N V+LT +S NS +Y SR+L+GL++ APK L + K GVP A+ ++A Sbjct: 294 AQILNFVVLTAALSVYNSGVYCNSRMLYGLAEQGDAPKSLMKLNKQGVPLRALGISALIT 353 Query: 435 ALAYMETSTGGDKVFEWLLNITGVAGFFAWLFISISHIRFMQALKYRGISRDELPFKAKL 494 L + ++ E L + + W IS++H++F +A+ RGI FKA Sbjct: 354 MLCVVVNYVAPNEALELLFALVVASLMINWAMISLTHLKFRKAMGQRGIVPG---FKAFW 410 Query: 495 MPGLAYYAATFMTIIIII 512 P Y FM +II + Sbjct: 411 SPYTNYLCLAFMAMIIYV 428 Lambda K H 0.325 0.140 0.438 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 702 Number of extensions: 43 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 590 Length of database: 466 Length adjustment: 35 Effective length of query: 555 Effective length of database: 431 Effective search space: 239205 Effective search space used: 239205 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.0 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.6 bits) S2: 52 (24.6 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory