Align general amino acid permease AGP1 (characterized)
to candidate AO353_05965 AO353_05965 aromatic amino acid transporter
Query= CharProtDB::CH_091105 (633 letters) >FitnessBrowser__pseudo3_N2E3:AO353_05965 Length = 466 Score = 220 bits (560), Expect = 1e-61 Identities = 144/456 (31%), Positives = 222/456 (48%), Gaps = 30/456 (6%) Query: 116 LKKTIQPRHVLMIALGTGIGTGLLVGNGTALVHAGPAGLLIGYAIMGSILYCIIQACGEM 175 LK+ ++ RH+ +IALG IGTGL +G+ L AGP+ +++GYAI G I + I++ GEM Sbjct: 11 LKRGLKNRHIQLIALGGAIGTGLFLGSAGVLKSAGPS-MILGYAIAGFIAFLIMRQLGEM 69 Query: 176 ALVYSNLTGGYNAYPSFLVDDGFGFAVAWVYCLQWLCVCPLELVTASMTIKYWTTSVNPD 235 +V + G ++ + GF W Y + ++ V EL +++W V Sbjct: 70 -IVEEPVAGSFSHFAHNYWGSFAGFLSGWNYWVLYVLVGMAELTAVGKYVQFWWPEVPTW 128 Query: 236 VFVIIFYVLVITINIFGARGYAEAEFFFNCCKILMMTGFFILGIIIDVGGAGNDGFIGGK 295 V +F+VLV IN + + E EF+F K++ + G LG + V G G Sbjct: 129 VSAAVFFVLVNLINTMNVKVFGEMEFWFAIIKVVAIIGMIALGCYMLVSGTGGPQASVSN 188 Query: 296 YWHDPGAF-NGKHAIDRFKGVAATLVTAAFAFGGSEFIAITTAEQSNPRKAIPGAAKQMI 354 W G F NG + G+ + F+FGG E + IT AE S PRK IP A Q++ Sbjct: 189 LWSHGGFFPNGTN------GLLMAMAFIMFSFGGLELVGITAAEASEPRKVIPKAINQVV 242 Query: 355 YRILFLFLATIILLGFLVPYNSD-QLLGSTGGGTKASPYVIAVASHGVRVVPHFINAVIL 413 YR+L ++ + +L L P++ Q LG++G SP+V A G +N V+L Sbjct: 243 YRVLIFYVGALTVLLSLYPWDQLLQTLGASGDAYSGSPFVQIFALIGSNTAAQILNFVVL 302 Query: 414 LSVLSMANSSFYSSARLFLTLSEQGYAPKVFSYIDRAGRPLIAMGVSALFAVIAFCAASP 473 + LS+ NS Y ++R+ L+EQG APK +++ G PL A+G+SAL ++ Sbjct: 303 TAALSVYNSGVYCNSRMLYGLAEQGDAPKSLMKLNKQGVPLRALGISALITMLCVVVNYV 362 Query: 474 KEEQVFTWLLAISGLSQLFTWTAICLSHLRFRRAMKVQGRSLGELGFKSQ---------- 523 + L A+ S + W I L+HL+FR+AM +G G F S Sbjct: 363 APNEALELLFALVVASLMINWAMISLTHLKFRKAMGQRGIVPGFKAFWSPYTNYLCLAFM 422 Query: 524 ----------TGVWGSAYACIMMILILIAQFWVAIA 549 GV S YA + +LIL + + +A Sbjct: 423 AMIIYVMLLIPGVRASVYAIPVWVLILFVFYRIRVA 458 Lambda K H 0.324 0.138 0.424 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 690 Number of extensions: 36 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 633 Length of database: 466 Length adjustment: 35 Effective length of query: 598 Effective length of database: 431 Effective search space: 257738 Effective search space used: 257738 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.0 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (22.0 bits) S2: 52 (24.6 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory