Align ABC transporter for L-Asparagine and possibly other L-amino acids, permease component 2 (characterized)
to candidate AO353_12325 AO353_12325 ABC transporter permease
Query= reanno::pseudo13_GW456_L13:PfGW456L13_4772 (223 letters) >FitnessBrowser__pseudo3_N2E3:AO353_12325 Length = 319 Score = 121 bits (304), Expect = 1e-32 Identities = 76/213 (35%), Positives = 114/213 (53%), Gaps = 12/213 (5%) Query: 10 PSLPGLWNGMIMTLKLMAMGVIGGIILGTILALMRLSHNKVLSNIAGAYVNYFRSIPLLL 69 P L GLW TL L + + G+++G L RLS+N L +++ Y+ R PLL+ Sbjct: 116 PLLWGLWT----TLWLSLVSGVLGLLIGLATGLCRLSNNPTLRDLSTVYIELVRGTPLLV 171 Query: 70 VITWFYLAVPFVLRWITGEDTPIGAFASCIVAFMMFEAAYFCEIVRAGVQSIPKGQMGAA 129 I FY + VL + + I A +F AY EI+R+GVQSI +GQ AA Sbjct: 172 QIFIFYFFIGTVLN--------LSREFAGIAALSLFTGAYVAEIIRSGVQSIARGQNEAA 223 Query: 130 QALGMSYGQMMRLIILPQAFRKMTPLLLQQSIILFQDTSLVYAVGLVDFLNASRASGDII 189 ++LG+S GQ MR ++LPQAF+++ P L Q I L +DTSLV + + + L + R Sbjct: 224 RSLGLSAGQSMRHVVLPQAFKRVLPPLAGQFISLVKDTSLVSVIAITELLKSGREVITTS 283 Query: 190 GRSNEFLIFAGLVYFIISFAASQLVKRLQKRFA 222 E L +Y +I+ S++ RL++R A Sbjct: 284 FSPFEILFCVAGLYLLINLPLSKIASRLERRLA 316 Lambda K H 0.332 0.144 0.428 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 168 Number of extensions: 7 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 223 Length of database: 319 Length adjustment: 25 Effective length of query: 198 Effective length of database: 294 Effective search space: 58212 Effective search space used: 58212 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.2 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.9 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory