GapMind for catabolism of small carbon sources

 

Aligments for a candidate for bztB in Pseudomonas fluorescens FW300-N2E3

Align glutamate/glutamine/aspartate/asparagine transport system permease protein BztB (characterized)
to candidate AO353_04610 AO353_04610 amino acid ABC transporter permease

Query= CharProtDB::CH_011913
         (426 letters)



>lcl|FitnessBrowser__pseudo3_N2E3:AO353_04610 AO353_04610 amino acid
           ABC transporter permease
          Length = 393

 Score =  306 bits (783), Expect = 9e-88
 Identities = 182/421 (43%), Positives = 254/421 (60%), Gaps = 37/421 (8%)

Query: 8   PKAGFRLSMLIYDTRFRSITIQIVVLLLFLAGLVWLLNNAYVNLEAKGKDFNFSFLWTRA 67
           PK    LS    D R R+   QI+ ++  ++   +L NN   NL+ +G    FSFL   A
Sbjct: 8   PKQRLSLS----DPRVRAWLFQIITIVAVISMGWYLFNNTQTNLQHRGITSGFSFLERSA 63

Query: 68  GYDLAQTLIPYSNDDTHFRALIEGLLNTLLVSVLGCILATILGTIIGVLRLSQNWLVARI 127
           G+ +AQ LI Y+  D++ R  + GLLNTLLV+ +G ILATILG I+GV RLS+NW++ ++
Sbjct: 64  GFGIAQHLIDYTESDSYARVFVIGLLNTLLVTFIGVILATILGFIVGVARLSKNWIINKL 123

Query: 128 MTVYVETFRNIPLLLWILLMGTILAETRPVPKDFRLTEAMKAAGEEPKASMWFFDSVAVT 187
            TVYVETFRNIP LL IL     +  T P P++                S  F D+  V+
Sbjct: 124 ATVYVETFRNIPPLLQILFWYFAVFLTMPGPRN----------------SHNFADTFFVS 167

Query: 188 NRGTNLPAPAFDHSLGVVDLGWNLPVSLNALAILAVMSASFWGWRRFMARAKAVQEATGT 247
           +RG N+PA    +        W   +S+  +AI+A++    W  +RF        EATG 
Sbjct: 168 SRGLNMPAAQMANGF------WAFVISI-VVAIVAIVLMCRWANKRF--------EATGV 212

Query: 248 RPTTWWP--SLLILFAPISALLYGLGFHLDYPQITKFDFTGGFQMLHSFTALLIALTLYT 305
               +W   +L +L   + AL++G+  H + P++  F+F GG+ ++    AL +ALT+YT
Sbjct: 213 PFHKFWVGLALFLLIPALCALIFGVPLHWEMPKLQGFNFVGGWVLIPELLALTLALTVYT 272

Query: 306 AAFIAEIVRAGIQAISRGQTEAAYALGLRPGRTMSLVILPQALRVIVPPLISQFLNLTKN 365
           AAFIAEIVR+GI ++S GQTEAA +LGLR G T+  VI+PQALRVI+PPL SQ+LNL KN
Sbjct: 273 AAFIAEIVRSGINSVSHGQTEAARSLGLRNGPTLRKVIIPQALRVIIPPLTSQYLNLAKN 332

Query: 366 SSLAIAVSYMDLRGTLGGITLNQTGRELECMLLMMLIYLTISLTISSLMNLYNKSIKLKE 425
           SSLA  + Y ++     G  LNQTG+ +E + + M +YL IS++IS LMN YNK I L E
Sbjct: 333 SSLAAGIGYPEMVSLFAGTVLNQTGQAIEVIAITMSVYLAISISISLLMNWYNKRIALIE 392

Query: 426 R 426
           R
Sbjct: 393 R 393


Lambda     K      H
   0.326    0.139    0.419 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 381
Number of extensions: 12
Number of successful extensions: 3
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 426
Length of database: 393
Length adjustment: 31
Effective length of query: 395
Effective length of database: 362
Effective search space:   142990
Effective search space used:   142990
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.7 bits)
S2: 50 (23.9 bits)

This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer. Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the preprint on GapMind for carbon sources, or view the source code.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory