Align ABC transporter for L-asparagine and L-glutamate, periplasmic substrate-binding component (characterized)
to candidate AO353_08055 AO353_08055 ABC transporter
Query= reanno::pseudo1_N1B4:Pf1N1B4_771 (304 letters) >FitnessBrowser__pseudo3_N2E3:AO353_08055 Length = 300 Score = 350 bits (899), Expect = e-101 Identities = 181/281 (64%), Positives = 214/281 (76%), Gaps = 2/281 (0%) Query: 16 LISTPVFAAE--LTGTLKKIKESGTITLGHRDASIPFSYIADASGKPVGYSHDIQLKIVE 73 L+ T V AAE LTGTL KI + +ITLG+RDAS+PFSY+ D SG+P+GYS D+ KIVE Sbjct: 14 LLGTQVQAAEAPLTGTLSKIASANSITLGYRDASVPFSYVGDQSGQPMGYSVDLANKIVE 73 Query: 74 AIKKDLDMPNLQVKYNLVTSQTRIPLVQNGTVDVECGSTTNNVERQQQVDFSVGIFEIGT 133 I++ L +P L+VKYNLVTSQTRIPLVQNGTVD+ECGST VERQ+QV FS G + Sbjct: 74 RIQQKLALPQLKVKYNLVTSQTRIPLVQNGTVDLECGSTGVTVERQKQVAFSYGFIYVKG 133 Query: 134 KLLSKKDSAYKDFADLKGKNVVTTAGTTSERILKSMNADKQMGMNVISAKDHGESFQMLE 193 +LL+ DS K FADL+GK+VVTTAGTT+ER LKS NAD ++ M VISAKDHGE+FQML+ Sbjct: 134 QLLTASDSGIKSFADLRGKSVVTTAGTTNERFLKSYNADHKIDMFVISAKDHGEAFQMLQ 193 Query: 194 TGRAVAFMMDDALLAGEMAKAKKPTDWAVTGTAQSNEIYGCMVRKGDAPFKKAVDDAIIA 253 +GRA AF MDDALL GE AKA+ P W V G QS EIY CMVRK D F V+ A+ Sbjct: 194 SGRAAAFYMDDALLYGERAKARDPHKWVVVGEEQSREIYSCMVRKDDPQFLALVNGALAD 253 Query: 254 TYKSGEINKIYEKWFMQPIPPKGLNLMFPMSEELKALIANP 294 Y SGEIN IY++WF QPIPPKGLNL FPM+ ELKA+IA P Sbjct: 254 LYSSGEINGIYQRWFEQPIPPKGLNLEFPMTSELKAIIAKP 294 Lambda K H 0.315 0.131 0.365 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 290 Number of extensions: 3 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 304 Length of database: 300 Length adjustment: 27 Effective length of query: 277 Effective length of database: 273 Effective search space: 75621 Effective search space used: 75621 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory