GapMind for catabolism of small carbon sources

 

Aligments for a candidate for aatQ in Pseudomonas fluorescens FW300-N2E3

Align ABC transporter for L-aspartate, L-asparagine, L-glutamate, and L-glutamine, permease component 2 (characterized)
to candidate AO353_12325 AO353_12325 ABC transporter permease

Query= reanno::pseudo3_N2E3:AO353_16285
         (248 letters)



>lcl|FitnessBrowser__pseudo3_N2E3:AO353_12325 AO353_12325 ABC
           transporter permease
          Length = 319

 Score =  127 bits (319), Expect = 3e-34
 Identities = 68/211 (32%), Positives = 120/211 (56%), Gaps = 14/211 (6%)

Query: 28  GLGWTIAIAIVAWIIALMLGSVLGVMRTVPNRLVSGIATCYVELFRNVPLLVQLFIWYFL 87
           GL  T+ +++V+ ++ L++G   G+ R   N  +  ++T Y+EL R  PLLVQ+FI+YF 
Sbjct: 120 GLWTTLWLSLVSGVLGLLIGLATGLCRLSNNPTLRDLSTVYIELVRGTPLLVQIFIFYFF 179

Query: 88  VPDLLPQNLQDWYKQDLNPTTSAYLSVVVCLGLFTAARVCEQVRTGIQALPRGQESAARA 147
           +  +L                S   + +  L LFT A V E +R+G+Q++ RGQ  AAR+
Sbjct: 180 IGTVL--------------NLSREFAGIAALSLFTGAYVAEIIRSGVQSIARGQNEAARS 225

Query: 148 MGFKLPQIYWNVLLPQAYRIVIPPLTSEFLNVFKNSSVASLIGLMELLAQTKQTAEFSAN 207
           +G    Q   +V+LPQA++ V+PPL  +F+++ K++S+ S+I + ELL   ++    S +
Sbjct: 226 LGLSAGQSMRHVVLPQAFKRVLPPLAGQFISLVKDTSLVSVIAITELLKSGREVITTSFS 285

Query: 208 LFEAFTLATLIYFTLNMSLMLLMRMVEKKVA 238
            FE       +Y  +N+ L  +   +E+++A
Sbjct: 286 PFEILFCVAGLYLLINLPLSKIASRLERRLA 316


Lambda     K      H
   0.326    0.139    0.432 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 198
Number of extensions: 5
Number of successful extensions: 2
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 248
Length of database: 319
Length adjustment: 26
Effective length of query: 222
Effective length of database: 293
Effective search space:    65046
Effective search space used:    65046
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.7 bits)
S2: 47 (22.7 bits)

This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer. Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the preprint on GapMind for carbon sources, or view the source code.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory