Align major cell-binding factor (characterized)
to candidate AO353_11675 AO353_11675 cystine transporter subunit
Query= CharProtDB::CH_021449 (259 letters) >FitnessBrowser__pseudo3_N2E3:AO353_11675 Length = 266 Score = 85.1 bits (209), Expect = 1e-21 Identities = 76/260 (29%), Positives = 122/260 (46%), Gaps = 17/260 (6%) Query: 3 FRKSLLKLAVFALGACVAFSNANAAEGKLESIKSKGQLIVGVKNDVPHYALLDQATGEIK 62 FR++LL ++ + A A E +L+ IK G + VG++ P ++ +D A G++ Sbjct: 6 FRRNLLVGSLGLVLGAGLLGQAVAGE-QLQKIKEAGVINVGLEGTYPPFSFVD-ANGKLA 63 Query: 63 GFEVDVAKLLAKSILGDDKKIKLVAVNAKTRGPLLDNGSVDAVIATFTITPERKRIYNFS 122 GFEV+ ++ LAK + K+KL L++ +DAVI TI+ ERK+ Y+FS Sbjct: 64 GFEVEFSEALAKEL---GVKVKLQPTKWDGILAALESKRLDAVINQVTISEERKKKYDFS 120 Query: 123 EPYYQDAIGLLVLKEK----KYKSLADMKGANIGVAQAATTKKAIGEAAKKIGIDVKFSE 178 EPY I LVL +K K+ AD+ G +GV ++ + A G +V+ Sbjct: 121 EPYTVSGIQALVLTKKVAELNIKTAADLTGKKVGVGLGTNYEQWV--KANVPGAEVR--T 176 Query: 179 FPDYPSIKAALDAKRVDAFSVDKSILLGYVDDKSEILP--DSFEPQSYGIVTKKDDPAFA 236 + D P+ L R D +D+ L Y + ++F Q GI +K +P Sbjct: 177 YEDDPTKFQDLRVGRTDVILIDRLAALEYAKKAKDTTAAGEAFSRQEAGIALRKGEPELL 236 Query: 237 KYVDDFVKEHKNEIDALAKK 256 V+ + K D KK Sbjct: 237 AAVNKAI--DKLRADGTLKK 254 Lambda K H 0.316 0.135 0.372 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 164 Number of extensions: 14 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 259 Length of database: 266 Length adjustment: 25 Effective length of query: 234 Effective length of database: 241 Effective search space: 56394 Effective search space used: 56394 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory