GapMind for catabolism of small carbon sources

 

Aligments for a candidate for TM0027 in Pseudomonas fluorescens FW300-N2E3

Align TM0027, component of β-glucoside porter (Conners et al., 2005). Binds cellobiose, laminaribiose (Nanavati et al. 2006). Regulated by cellobiose-responsive repressor BglR (characterized)
to candidate AO353_21785 AO353_21785 microcin ABC transporter ATP-binding protein

Query= TCDB::Q9WXN4
         (268 letters)



>lcl|FitnessBrowser__pseudo3_N2E3:AO353_21785 AO353_21785 microcin
           ABC transporter ATP-binding protein
          Length = 526

 Score =  163 bits (412), Expect = 8e-45
 Identities = 95/257 (36%), Positives = 156/257 (60%), Gaps = 9/257 (3%)

Query: 4   LVVKNLTKIFSLG---FFSKRRIEAVKNVSFEVKEKEIVSLVGESGSGKTTTAKMILRLL 60
           L V +L   F LG   F  K  + AV  +S  ++  + + +VGESGSGK+T  + ILRLL
Sbjct: 270 LEVNDLNVRFPLGGGLFQRKTWLHAVDGISLSIQRGKTLGIVGESGSGKSTLGQAILRLL 329

Query: 61  PPTSGEIYFEGKDIWKDIKDRESLVEFRRKVHAVFQDPFASYNPFYPVERTLWQAISLLE 120
             + G I F+G+ +  D  +++ L  +R+++  VFQDPF S +P   V + + + + +  
Sbjct: 330 D-SDGSIRFQGEAL--DSLNQKQLRPWRKQMQVVFQDPFGSLSPRMSVAQIISEGLEV-- 384

Query: 121 NKPSNKKEALELIKESLFRVGIDPKDVLGKYPHQISGGQKQRIMIARCWILRPLLIVADE 180
           +  S+  E    + + L  VG+DP+    +YPH+ SGGQ+QRI IAR  +L+P LI+ DE
Sbjct: 385 HSQSSAAECETQVIQVLKEVGLDPQS-RHRYPHEFSGGQRQRIAIARALVLKPALILLDE 443

Query: 181 PTSMIDASSRGGIIKLLEELREEQGTSIIFITHDLGLAYYVSDNIFVMKNGEIVERGHPD 240
           PTS +D + +  ++ LL +L+E+ G + +FI+HDL +   ++ ++ V+K+G++VERG   
Sbjct: 444 PTSALDRTVQKQVVALLRQLQEKYGLTYLFISHDLAVIRALAHDMIVIKDGKVVERGASH 503

Query: 241 KVVLEPTHEYTKLLVGS 257
            V   P H YTK L+ +
Sbjct: 504 DVFAAPQHPYTKELLAA 520



 Score =  160 bits (405), Expect = 5e-44
 Identities = 94/242 (38%), Positives = 149/242 (61%), Gaps = 10/242 (4%)

Query: 25  AVKNVSFEVKEKEIVSLVGESGSGKTTTAKMILRLLPP----TSGEIYFEGKD-IWKDIK 79
           AV+NV  +++  E ++LVGESGSGK+ TA+ IL+LLP     T G I + G++ I  D+ 
Sbjct: 20  AVRNVCLDIRPGECLALVGESGSGKSVTAQSILQLLPDGGTETRGSIRYRGQELIGADVA 79

Query: 80  DRESLVEFRRKVHAVFQDPFASYNPFYPVERTLWQAISLLENKPSNKKEALELIKESLFR 139
              +L   R  +  +FQ+P  S NP + VE+ + +  +LL +K    K A +   E L  
Sbjct: 80  TLRALRGNR--IAMIFQEPMTSLNPLHSVEKQIGE--TLLVHKGLGDKAAQKRTLELLEL 135

Query: 140 VGID-PKDVLGKYPHQISGGQKQRIMIARCWILRPLLIVADEPTSMIDASSRGGIIKLLE 198
           VGI  P++ L  YPHQ+SGGQ+QR+MIA      P L++ADEPT+ +D + +  I++LL+
Sbjct: 136 VGIKKPEERLKAYPHQLSGGQRQRVMIAMALACEPELLIADEPTTALDVTVQRKILRLLK 195

Query: 199 ELREEQGTSIIFITHDLGLAYYVSDNIFVMKNGEIVERGHPDKVVLEPTHEYTKLLVGSI 258
            L++  G S++ I+HDL L   ++  + VM  GEIVE+   +++   P H Y++LL+ + 
Sbjct: 196 SLQQRLGMSLLLISHDLNLVRSIAQRVCVMHAGEIVEQAECERLFNHPQHPYSRLLLNAE 255

Query: 259 PK 260
           P+
Sbjct: 256 PE 257


Lambda     K      H
   0.319    0.139    0.397 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 382
Number of extensions: 18
Number of successful extensions: 6
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 2
Number of HSP's successfully gapped: 2
Length of query: 268
Length of database: 526
Length adjustment: 30
Effective length of query: 238
Effective length of database: 496
Effective search space:   118048
Effective search space used:   118048
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 50 (23.9 bits)

This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the paper from 2022 on GapMind for carbon sources, or view the source code.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory