Align Binding-protein-dependent transport systems inner membrane component (characterized, see rationale)
to candidate AO353_25125 AO353_25125 sugar ABC transporter permease
Query= uniprot:A3DE71 (289 letters) >FitnessBrowser__pseudo3_N2E3:AO353_25125 Length = 280 Score = 155 bits (391), Expect = 1e-42 Identities = 88/269 (32%), Positives = 147/269 (54%), Gaps = 9/269 (3%) Query: 24 ILAILVVLTLGPIVFMVLTSLMDHNAIAR-GKWIAPTRFSNYVEVFQKLPFGIYFRNSLI 82 ++ IL++ + P + ++TSL +A+ WI FSNY V + F NSL+ Sbjct: 18 LIGILLLYAVFPFYYAIVTSLKPSSALFEVSYWIDSPDFSNYAAVLHQSSFLRAIGNSLV 77 Query: 83 VCSIVMVVALVIATLAGYSLAKYKFPGSGFFGILILATQLLPGMMFLLPLYLDFVKIKQA 142 V V+ +AL ++ A Y+L + KF G G +++L + P + L L+ ++ +A Sbjct: 78 VALCVVTLALFLSLTAAYALGRVKFRGRGTVLMMVLGVSMFPQVAVLSGLF----EVIRA 133 Query: 143 TGIQLINSIPGLVIVYSAFFVPFSIWIIRGFFASIPGELEEAARIDGCNKFTAFLRVMLP 202 G L N+ L++ Y+ F +PF++W++ F +P ELEEAA +DG + + RV+LP Sbjct: 134 LG--LYNTSWALILSYTIFTLPFTVWVLTTFMGQLPHELEEAAIMDGASPWVTLTRVLLP 191 Query: 203 LAVPGIVATAIYIFLTAWDELIFAWVLLKDTKVTTIPAGIRGFIAYTTAR--YDLLMAAG 260 L P +V T + F+ AW+E +FA T+P I + + LLMAA Sbjct: 192 LLWPALVTTGLLAFIAAWNEFLFALTFTLTDTQRTVPVAIALISGGSPHELPWGLLMAAS 251 Query: 261 TIVTIPVLIMFFTMQKKFISGMTAGAVKG 289 +VT+P++I+ Q++ +SG+TAGA+KG Sbjct: 252 VLVTVPLVILVLIFQRRIVSGLTAGALKG 280 Lambda K H 0.332 0.145 0.434 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 225 Number of extensions: 11 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 289 Length of database: 280 Length adjustment: 26 Effective length of query: 263 Effective length of database: 254 Effective search space: 66802 Effective search space used: 66802 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.2 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.9 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory