Align Binding-protein-dependent transport systems inner membrane component (characterized, see rationale)
to candidate AO353_27035 AO353_27035 molybdenum ABC transporter permease
Query= uniprot:A3DE71 (289 letters) >FitnessBrowser__pseudo3_N2E3:AO353_27035 Length = 226 Score = 46.2 bits (108), Expect = 7e-10 Identities = 45/145 (31%), Positives = 70/145 (48%), Gaps = 9/145 (6%) Query: 80 SLIVCSIVMVVALVIATLAGYSLAKYKFPGSGFFGILILATQLLP----GMMFLLPLYLD 135 +L + S+ + LVI T L++ + G G ++ +LP G LL L + Sbjct: 14 TLKLASLTTAILLVIGTPIALWLSRTRSWLRGPIGAIVALPLVLPPTVIGFYLLLTLGPN 73 Query: 136 FV--KIKQATGIQLIN-SIPGLVIVYSAFFVPFSIWIIRGFFASI-PGELEEAARIDGCN 191 V + QA G+ + S GLVI + +PF + ++ F++I P LE AA + N Sbjct: 74 GVIGQFTQALGLGTLTFSFAGLVIGSVIYSMPFVVQPLQNAFSAIGPRPLEVAATLRA-N 132 Query: 192 KFTAFLRVMLPLAVPGIVATAIYIF 216 + F V+LPLA PG + AI F Sbjct: 133 PWDTFFTVILPLARPGFITAAILGF 157 Lambda K H 0.332 0.145 0.434 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 156 Number of extensions: 8 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 289 Length of database: 226 Length adjustment: 24 Effective length of query: 265 Effective length of database: 202 Effective search space: 53530 Effective search space used: 53530 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.2 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.9 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory