Align citrate lyase holo-[acyl-carrier protein] synthase (EC 2.7.7.61) (characterized)
to candidate AO353_24495 AO353_24495 malate permease
Query= BRENDA::Q8VS41 (454 letters) >FitnessBrowser__pseudo3_N2E3:AO353_24495 Length = 447 Score = 320 bits (821), Expect = 5e-92 Identities = 162/436 (37%), Positives = 266/436 (61%), Gaps = 4/436 (0%) Query: 15 IDTPKTTLKQRWWHIMDNWKVGIVPLPLFLLAGGLIALDCLGGKLPSDIVVMVATLAFFG 74 ID P+ + R + +++G++PLP+FL ++ L G LP++++ +A + G Sbjct: 11 IDAPRDG-RLRQLRSLCGYEIGVIPLPIFLGIAVIVYLSAHLGFLPNNMIGGLAVIMTMG 69 Query: 75 FACGEFGKRLPVLGKLGAAAICATFIPSALVHYGLLPDVVIESTTKFYKSTNILYLYICC 134 G+ G RLP+L ++G AI +PS LV YG I++T K N LY I Sbjct: 70 MFFGQLGSRLPILKEIGGGAILCLMLPSILVFYGFFGPATIDATKMLMKEANFLYFVIAS 129 Query: 135 IIVGSIMSMNRTTLIQGFLKIFFPMLCGEVVGMLVGIGVGTLLGMEPFQVFFFIVLPIMA 194 ++VGSI+ M+R LIQG +++F P+L G + + G+ VG L+G + FFFI++PI+ Sbjct: 130 LVVGSILGMSRFILIQGMMRMFIPLLVGTLAAVASGLIVGKLVGYSFYHTFFFIIVPIIG 189 Query: 195 GGVGEGAIPLSMGYAALMHMEQGVALGRVLPMVMLGSLTAIVISGCLNQLGKRFPHLTGE 254 GG+GEG +PLS+ Y+A++ + + +++P ++G++ AI+ +G L +L + PHL GE Sbjct: 190 GGIGEGILPLSLAYSAILGGTPDIYVAKLVPAAVVGNIAAIICAGYLARLALKRPHLNGE 249 Query: 255 GQLMPNRSHETRSLSESEGVSGKT-DVGTLASGALLAVLLYMMGMLGHKLIGLPAPVGML 313 G L+ R+ + ++ +G T D + +G L+ +++G L K++G+P PV M+ Sbjct: 250 GSLI--RAKDENDKFQAREDNGSTIDFRVIGAGILVICAFFVLGGLLEKILGVPGPVLMI 307 Query: 314 FLAVLLKLANVVSPRLQEGSQMVYKFFRTAVTYPILFAVGVAITPWQELVNAFTLTNLLV 373 AVL K V+ +L++G+ YK +A +P++ +G+ P +V F+++ +LV Sbjct: 308 LAAVLFKYIRVLPEKLEKGTNAFYKLISSAFIWPVMIGLGMLYVPLDSVVKVFSISYVLV 367 Query: 374 IVSTVSALVATGFLVGKKIGMHPIDVAIVSCCQSGQGGTGDVAILTAGNRMSLMPFAQIA 433 VS V+++ GF +G + M+PI+ AIV+CC SG GGTGDVAIL+A NRMSLMPFAQI+ Sbjct: 368 CVSVVASMAIAGFFIGNLMKMYPIESAIVTCCHSGLGGTGDVAILSASNRMSLMPFAQIS 427 Query: 434 TRIGGAINVSLGLLFL 449 TR+GGA V + + L Sbjct: 428 TRLGGASTVIIASILL 443 Lambda K H 0.326 0.142 0.428 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 757 Number of extensions: 61 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 454 Length of database: 447 Length adjustment: 33 Effective length of query: 421 Effective length of database: 414 Effective search space: 174294 Effective search space used: 174294 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.7 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory