Align ABC transporter substrate-binding protein; SubName: Full=Histidine transport system substrate-binding protein (characterized, see rationale)
to candidate AO353_01540 AO353_01540 ABC transporter substrate-binding protein
Query= uniprot:A0A1N7UK26 (258 letters) >FitnessBrowser__pseudo3_N2E3:AO353_01540 Length = 259 Score = 277 bits (708), Expect = 2e-79 Identities = 139/255 (54%), Positives = 181/255 (70%), Gaps = 4/255 (1%) Query: 5 RSLFAALLLPLC---ATAHAQEWKEIRFGVFPEYPPFESVAADGSLQGFDIELGNAICAK 61 R+L L LC A A+E+KE+RFGV P Y PFES AADGSL GFDI+LGNAICA+ Sbjct: 3 RTLLTLSALTLCMAAGVATAKEYKELRFGVDPSYAPFESKAADGSLVGFDIDLGNAICAE 62 Query: 62 LEVKCTWVHNEFDGMIPALRARKFDAIMSSMAVTPAREKIIDFSDRLFLSPTSVITRKSA 121 L+VKC WV ++FDG IP L+A KFD ++SSM VTPAREK+IDFS LF PT+++ +K + Sbjct: 63 LKVKCKWVESDFDGTIPGLKANKFDGVISSMTVTPAREKVIDFSSELFSGPTALVYKKGS 122 Query: 122 DFGDTPESLMGKQVGVLQGSLQEAYARAHLAKLGAQIKAYQSQDQNYADLQNGRLDATLT 181 D SL GK+VG QG++QEAYA+A L K G + KAY +QDQ YADL +GRLDAT+ Sbjct: 123 SVSDV-ASLKGKKVGYEQGTIQEAYAKAVLDKAGVETKAYANQDQVYADLMSGRLDATIQ 181 Query: 182 DKLEAQLNFLSKPEGSDFKTGPAFKDPTLPLDIAMGLRKNDQALRALINKGIAAVQADGT 241 D L+A+L+FL P+G+D++ LP A+G+ K + L+AL++KGI A+ DGT Sbjct: 182 DMLQAKLSFLKSPQGADYEVSQPIDSELLPAKTAVGIAKGNTELKALLDKGIKAIHDDGT 241 Query: 242 YAQIQKKYFGDQDIY 256 Y IQKK+FGD +Y Sbjct: 242 YDSIQKKHFGDLSLY 256 Lambda K H 0.319 0.135 0.393 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 212 Number of extensions: 8 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 258 Length of database: 259 Length adjustment: 24 Effective length of query: 234 Effective length of database: 235 Effective search space: 54990 Effective search space used: 54990 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory