GapMind for catabolism of small carbon sources


Aligments for a candidate for astD in Pseudomonas fluorescens FW300-N2E3

Align Succinylglutamic semialdehyde dehydrogenase (EC (characterized)
to candidate AO353_03010 AO353_03010 succinylglutamate-semialdehyde dehydrogenase

Query= reanno::pseudo13_GW456_L13:PfGW456L13_1974
         (488 letters)

>lcl|FitnessBrowser__pseudo3_N2E3:AO353_03010 AO353_03010
           succinylglutamate-semialdehyde dehydrogenase
          Length = 487

 Score =  904 bits (2337), Expect = 0.0
 Identities = 454/487 (93%), Positives = 469/487 (96%)









Query: 481 LTPGVKM 487
Sbjct: 481 LTPGVRM 487

Lambda     K      H
   0.316    0.132    0.388 

Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 886
Number of extensions: 20
Number of successful extensions: 1
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 488
Length of database: 487
Length adjustment: 34
Effective length of query: 454
Effective length of database: 453
Effective search space:   205662
Effective search space used:   205662
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 52 (24.6 bits)

Align candidate AO353_03010 AO353_03010 (succinylglutamate-semialdehyde dehydrogenase)
to HMM TIGR03240 (astD: succinylglutamate-semialdehyde dehydrogenase (EC

# hmmsearch :: search profile(s) against a sequence database
# HMMER 3.3.1 (Jul 2020);
# Copyright (C) 2020 Howard Hughes Medical Institute.
# Freely distributed under the BSD open source license.
# - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
# query HMM file:                  ../tmp/path.carbon/TIGR03240.hmm
# target sequence database:        /tmp/gapView.7273.genome.faa
# - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query:       TIGR03240  [M=484]
Accession:   TIGR03240
Description: arg_catab_astD: succinylglutamate-semialdehyde dehydrogenase
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence                                     Description
    ------- ------ -----    ------- ------ -----   ---- --  --------                                     -----------
   2.3e-257  840.3   1.6   2.5e-257  840.2   1.6    1.0  1  lcl|FitnessBrowser__pseudo3_N2E3:AO353_03010  AO353_03010 succinylglutamate-se

Domain annotation for each sequence (and alignments):
>> lcl|FitnessBrowser__pseudo3_N2E3:AO353_03010  AO353_03010 succinylglutamate-semialdehyde dehydrogenase
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  840.2   1.6  2.5e-257  2.5e-257       1     483 [.       4     486 ..       4     487 .] 1.00

  Alignments for each domain:
  == domain 1  score: 840.2 bits;  conditional E-value: 2.5e-257
                                     TIGR03240   1 lfidGkwraGqGeslesldpvtqevlwqgkaasaaqvekavkaarkafpawarlsleeriavvkr 65 
                                                   l+i G+w aGqG+ +esl+pvtq+vlw+g++asaaqve+av+aar+afpawa++sle+ri v+++
                                                   59*************************************************************** PP

                                     TIGR03240  66 faelleeekeelaeviaketgkplweartevasmvakvaisikayeertGekeseladakavlrh 130
                                                   fa+ l+++++ela++i++etgkplwea+tev+smv+k+ais+++y+ertGek+ +l+da+avlrh
                                                   ***************************************************************** PP

                                     TIGR03240 131 rphGvlavfGpynfpGhlpnGhivpallaGntvvfkpseltplvaeetvklwekaGlpaGvlnlv 195
                                                   +phGv+avfGpynfpGhlpnGhivpallaGn+v+fkpseltp+vae tvk+w +aGlpaGvlnl+
                                                   ***************************************************************** PP

                                     TIGR03240 196 qGaretGkalaaeedidGllftGssntGallhrqlagrpekilalelGGnnplvveevkdidaav 260
                                                   qGaretG alaa+++idGl+ftGss+tG++lh q++grp+kilale+GGnnplvv++v+d+daav
                                                   ***************************************************************** PP

                                     TIGR03240 261 hlivqsafisaGqrctcarrllvkdgaeGdallerlvevaerltvgkydaepqpflGavisekaa 325
                                                   ++i+qsafisaGqrctcarrllv++ga+Gd+ll+rlv+v++++ vg++d++p+pf+G+v+s  aa
                                                   ***************************************************************** PP

                                     TIGR03240 326 kellaaqekllalggksllelkqleeeaalltpgiidvtevaevpdeeyfgpllkvlrykdfdea 390
                                                   k+l++aqe+lla+g+  ll+++q +++aalltpgi+dv++v+++pdee+fgpll+v+ry+df++a
                                                   ***************************************************************** PP

                                     TIGR03240 391 laeanntrfGlaaGllsddrelydkflleiraGivnwnkpltGassaapfGGiGasGnhrpsayy 455
                                                   ***************************************************************** PP

                                     TIGR03240 456 aadycaypvasleadslalpatlspGlk 483
                                                   aadycaypvasle+ sl+lpa l+pG++
  lcl|FitnessBrowser__pseudo3_N2E3:AO353_03010 459 AADYCAYPVASLETPSLTLPAALTPGVR 486
                                                   **************************97 PP

Internal pipeline statistics summary:
Query model(s):                            1  (484 nodes)
Target sequences:                          1  (487 residues searched)
Passed MSV filter:                         1  (1); expected 0.0 (0.02)
Passed bias filter:                        1  (1); expected 0.0 (0.02)
Passed Vit filter:                         1  (1); expected 0.0 (0.001)
Passed Fwd filter:                         1  (1); expected 0.0 (1e-05)
Initial search space (Z):                  1  [actual number of targets]
Domain search space  (domZ):               1  [number of targets reported over threshold]
# CPU time: 0.02u 0.01s 00:00:00.03 Elapsed: 00:00:00.02
# Mc/sec: 8.43

This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.



Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the preprint on GapMind for carbon sources, or view the source code.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory