Align Succinylglutamate desuccinylase (EC 3.5.1.96) (characterized)
to candidate AO353_02995 AO353_02995 succinylglutamate desuccinylase
Query= reanno::pseudo13_GW456_L13:PfGW456L13_1977 (336 letters) >lcl|FitnessBrowser__pseudo3_N2E3:AO353_02995 AO353_02995 succinylglutamate desuccinylase Length = 336 Score = 609 bits (1570), Expect = e-179 Identities = 307/336 (91%), Positives = 321/336 (95%) Query: 1 MLALGKLLELTLAGREPAEKTQLTVEGVRMRWLSEGALEVRPPEARDNGLDLLLSAGIHG 60 MLALGKLLELTLAGREPAEKTQLTVEGVRMRWLSEGALEVRPPEARDNGLDLLLSAGIHG Sbjct: 1 MLALGKLLELTLAGREPAEKTQLTVEGVRMRWLSEGALEVRPPEARDNGLDLLLSAGIHG 60 Query: 61 NETAPIELLDRLLHDIARGDLKPRARILFLFGNPEAIRKGERFVEQDVNRLFNGRHEQSS 120 NETAPIELLDRLLHDIARG+LKPRARILFLFGNP+A+R+GERF+EQDVNRLFNGRHE SS Sbjct: 61 NETAPIELLDRLLHDIARGELKPRARILFLFGNPDAMRRGERFIEQDVNRLFNGRHELSS 120 Query: 121 GCEALRACELERLAASFFSLPDRQRLHYDLHTAIRGSKIEQFALYPWKEDRQHSRQELAR 180 G EALRACELERLAASFF+LPDR RLHYDLHTAIRGSKIEQFALYPWKE RQHSR ELAR Sbjct: 121 GSEALRACELERLAASFFNLPDRARLHYDLHTAIRGSKIEQFALYPWKEGRQHSRHELAR 180 Query: 181 LRAAGMEAVLLQNKPSIVFSSYTYDKLGAEAFTLELGKARPFGQNDGVNVSLLEKRLKQI 240 LRAAGMEAVLLQNKPSIVFSSYTYDKL AE+FTLELGKARPFGQNDGVNVS LE LKQI Sbjct: 181 LRAAGMEAVLLQNKPSIVFSSYTYDKLDAESFTLELGKARPFGQNDGVNVSRLETLLKQI 240 Query: 241 IEGTEPELTEDALDGLQLYSVAREIIKHSDSFRLNLPADIENFSELEVGYLLAEDIANTR 300 IEGTEPE E++LDGLQL+SVAREIIKHSDSF LNLPADIENFSEL+ GYLLAEDIA TR Sbjct: 241 IEGTEPESAEESLDGLQLFSVAREIIKHSDSFHLNLPADIENFSELKKGYLLAEDIAQTR 300 Query: 301 WIIEEEGARIIFPNPRVKNGLRAGILVVPTTDENLA 336 WI+EEEGARIIFPNP+VKNGLRAGIL+VPTT ENLA Sbjct: 301 WIVEEEGARIIFPNPKVKNGLRAGILIVPTTAENLA 336 Lambda K H 0.319 0.138 0.394 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 497 Number of extensions: 19 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 336 Length of database: 336 Length adjustment: 28 Effective length of query: 308 Effective length of database: 308 Effective search space: 94864 Effective search space used: 94864 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 49 (23.5 bits)
Align candidate AO353_02995 AO353_02995 (succinylglutamate desuccinylase)
to HMM TIGR03242 (astE: succinylglutamate desuccinylase (EC 3.5.1.96))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.carbon/TIGR03242.hmm # target sequence database: /tmp/gapView.20368.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR03242 [M=319] Accession: TIGR03242 Description: arg_catab_astE: succinylglutamate desuccinylase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 5e-124 399.7 0.0 5.6e-124 399.5 0.0 1.0 1 lcl|FitnessBrowser__pseudo3_N2E3:AO353_02995 AO353_02995 succinylglutamate de Domain annotation for each sequence (and alignments): >> lcl|FitnessBrowser__pseudo3_N2E3:AO353_02995 AO353_02995 succinylglutamate desuccinylase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 399.5 0.0 5.6e-124 5.6e-124 1 319 [] 6 328 .. 6 328 .. 0.95 Alignments for each domain: == domain 1 score: 399.5 bits; conditional E-value: 5.6e-124 TIGR03242 1 dflaltlekkep.evtqgeaknvklrwldeGvlelePe..aeaekslvisaGihGnetaPielle 62 ++l+ltl+ +ep e+tq + ++v++rwl eG+le++P ++ +l++saGihGnetaPiell+ lcl|FitnessBrowser__pseudo3_N2E3:AO353_02995 6 KLLELTLAGREPaEKTQLTVEGVRMRWLSEGALEVRPPeaRDNGLDLLLSAGIHGNETAPIELLD 70 589******9997889999*****************9855677889******************* PP TIGR03242 63 qllsdiaagklqlkvrlLlilGnpaalrkgkRyleedlnRlfgGryqeleeskeklRaeeLeqvv 127 +ll+dia+g+l+ ++r+L+++Gnp a+r+g+R++e+d+nRlf+Gr+ el+++ e+lRa eLe + lcl|FitnessBrowser__pseudo3_N2E3:AO353_02995 71 RLLHDIARGELKPRARILFLFGNPDAMRRGERFIEQDVNRLFNGRH-ELSSGSEALRACELERLA 134 **********************************************.9***************** PP TIGR03242 128 eaffeagkasearyhyDlhtaiRasklekfallPyq.ekpfdkellewlaaadldavllhkekgg 191 + ff+ + ++ r+hyDlhtaiR+sk+e+fal+P + ++++++++l++l+aa+++avll++++++ lcl|FitnessBrowser__pseudo3_N2E3:AO353_02995 135 ASFFNLPDRA--RLHYDLHTAIRGSKIEQFALYPWKeGRQHSRHELARLRAAGMEAVLLQNKPSI 197 *******999..8**********************999*************************** PP TIGR03242 192 tfshfssekleaeactlelGkarPfGendlsqfqaitealralisdea..iparkkeelklfevv 254 fs ++++kl+ae++tlelGkarPfG+nd ++++ +++ l+++i +++ ++++ + l+lf+v lcl|FitnessBrowser__pseudo3_N2E3:AO353_02995 198 VFSSYTYDKLDAESFTLELGKARPFGQNDGVNVSRLETLLKQIIEGTEpeSAEESLDGLQLFSVA 262 ********************************************66541133444459******* PP TIGR03242 255 esilkksdsfelhvaedasnftefakGtllaedkde.ryrveeeeerilfPnakvanGlRaglll 318 ++i+k+sdsf+l++++d++nf+e++kG+llaed ++ r++veee++ri+fPn+kv+nGlRag+l+ lcl|FitnessBrowser__pseudo3_N2E3:AO353_02995 263 REIIKHSDSFHLNLPADIENFSELKKGYLLAEDIAQtRWIVEEEGARIIFPNPKVKNGLRAGILI 327 *********************************9988**************************99 PP TIGR03242 319 v 319 v lcl|FitnessBrowser__pseudo3_N2E3:AO353_02995 328 V 328 6 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (319 nodes) Target sequences: 1 (336 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.00s 00:00:00.01 Elapsed: 00:00:00.01 # Mc/sec: 10.60 // [ok]
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the paper from 2022 on GapMind for carbon sources, or view the source code.
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory