Align 2-deoxy-D-ribonate transporter 1 (characterized)
to candidate AO353_24515 AO353_24515 MFS transporter permease
Query= reanno::WCS417:GFF1429 (438 letters) >lcl|FitnessBrowser__pseudo3_N2E3:AO353_24515 AO353_24515 MFS transporter permease Length = 432 Score = 295 bits (755), Expect = 2e-84 Identities = 159/409 (38%), Positives = 236/409 (57%), Gaps = 14/409 (3%) Query: 20 KLMPLLIIAYILSFLDRTNIALAKHHLDVDLGISAAAYGLGAGLFFLTYALSEIPSNLIM 79 +LMP L++ Y+ ++LDR N+ AK + DL +S YGLGAG+FF+ Y L E+PSN+I+ Sbjct: 23 RLMPFLMLCYLCAYLDRVNVGFAKLQMMNDLALSETVYGLGAGMFFIGYFLCEVPSNIIL 82 Query: 80 HKVGARFWIARIMVTWGLISAAMAFVQGETSFYVLRLLLGIAEAGLFPGVMLYLTYWFNR 139 HKVGAR WIARIM+TWG++SA AFV+ FY LR LLGIAEAGL PG++LYLTYWF Sbjct: 83 HKVGARVWIARIMITWGIVSALFAFVETAWQFYALRFLLGIAEAGLAPGLLLYLTYWFPS 142 Query: 140 EQRARATGYFLLGVCFANIIGGPVGAALM-RMDGMLGWHGWQWMFMLEGLPAVAFAWVVW 198 +RAR T + + + + ++GGP+ +M GM GW GWQWMF+LE +P V +V Sbjct: 143 YRRARMTVLWFIAIPLSGMVGGPLSGWIMNHFAGMHGWAGWQWMFVLEAVPTVLIGLLVL 202 Query: 199 RKLPDRPSKAPWLSAEEARGIEQRIAQE-----TEEGAGEGGHSLKNWLTPQILLAIFVY 253 L D +A WL +E I + +A++ T GE + WL I Y Sbjct: 203 SYLKDGVHQASWLDDDEKALISRELAEDDQQKVTHASVGEFIRDRRLWLLAGI------Y 256 Query: 254 FCHQITIYTVIFFLPSIISKYGELSTMSVGLLTSLPWIAAALGALLIPRFATTPGRCRRL 313 FC + Y + F+LP+++ G + + +G L+SLP++ A L R R Sbjct: 257 FCVVMGQYAITFWLPTLVRNAGVSNPLHIGFLSSLPYLCAIAAMLYAGRSGDKHRERRWH 316 Query: 314 LVTGLLTMALGLGIASVSG--PVFSLLGFCLSAVMFFVVQSIIFLYPASRLKGVALAGGL 371 L+ ++ A+GL +A++ G + S+L CL+A S+ ++ P + L GV+ A G+ Sbjct: 317 LIVPMIAGAIGLSLAALMGGNVLLSILSLCLAASGILSATSMFWMLPTTLLGGVSAAAGI 376 Query: 372 GFVNACGLLGGFVGPSVMGVIEQSTGNAMNGLKVIALVLVVAALAALRL 420 VN+ L GF P ++G + TG++ G+ +I VL+ A LR+ Sbjct: 377 AAVNSFANLAGFCSPYLIGWVTTQTGSSAIGMYLITGVLLFGATLVLRI 425 Lambda K H 0.327 0.141 0.438 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 565 Number of extensions: 30 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 438 Length of database: 432 Length adjustment: 32 Effective length of query: 406 Effective length of database: 400 Effective search space: 162400 Effective search space used: 162400 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.7 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the preprint on GapMind for carbon sources, or view the source code.
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory