Align 2-deoxy-D-ribonate transporter 1 (characterized)
to candidate AO353_24515 AO353_24515 MFS transporter permease
Query= reanno::WCS417:GFF1429 (438 letters) >FitnessBrowser__pseudo3_N2E3:AO353_24515 Length = 432 Score = 295 bits (755), Expect = 2e-84 Identities = 159/409 (38%), Positives = 236/409 (57%), Gaps = 14/409 (3%) Query: 20 KLMPLLIIAYILSFLDRTNIALAKHHLDVDLGISAAAYGLGAGLFFLTYALSEIPSNLIM 79 +LMP L++ Y+ ++LDR N+ AK + DL +S YGLGAG+FF+ Y L E+PSN+I+ Sbjct: 23 RLMPFLMLCYLCAYLDRVNVGFAKLQMMNDLALSETVYGLGAGMFFIGYFLCEVPSNIIL 82 Query: 80 HKVGARFWIARIMVTWGLISAAMAFVQGETSFYVLRLLLGIAEAGLFPGVMLYLTYWFNR 139 HKVGAR WIARIM+TWG++SA AFV+ FY LR LLGIAEAGL PG++LYLTYWF Sbjct: 83 HKVGARVWIARIMITWGIVSALFAFVETAWQFYALRFLLGIAEAGLAPGLLLYLTYWFPS 142 Query: 140 EQRARATGYFLLGVCFANIIGGPVGAALM-RMDGMLGWHGWQWMFMLEGLPAVAFAWVVW 198 +RAR T + + + + ++GGP+ +M GM GW GWQWMF+LE +P V +V Sbjct: 143 YRRARMTVLWFIAIPLSGMVGGPLSGWIMNHFAGMHGWAGWQWMFVLEAVPTVLIGLLVL 202 Query: 199 RKLPDRPSKAPWLSAEEARGIEQRIAQE-----TEEGAGEGGHSLKNWLTPQILLAIFVY 253 L D +A WL +E I + +A++ T GE + WL I Y Sbjct: 203 SYLKDGVHQASWLDDDEKALISRELAEDDQQKVTHASVGEFIRDRRLWLLAGI------Y 256 Query: 254 FCHQITIYTVIFFLPSIISKYGELSTMSVGLLTSLPWIAAALGALLIPRFATTPGRCRRL 313 FC + Y + F+LP+++ G + + +G L+SLP++ A L R R Sbjct: 257 FCVVMGQYAITFWLPTLVRNAGVSNPLHIGFLSSLPYLCAIAAMLYAGRSGDKHRERRWH 316 Query: 314 LVTGLLTMALGLGIASVSG--PVFSLLGFCLSAVMFFVVQSIIFLYPASRLKGVALAGGL 371 L+ ++ A+GL +A++ G + S+L CL+A S+ ++ P + L GV+ A G+ Sbjct: 317 LIVPMIAGAIGLSLAALMGGNVLLSILSLCLAASGILSATSMFWMLPTTLLGGVSAAAGI 376 Query: 372 GFVNACGLLGGFVGPSVMGVIEQSTGNAMNGLKVIALVLVVAALAALRL 420 VN+ L GF P ++G + TG++ G+ +I VL+ A LR+ Sbjct: 377 AAVNSFANLAGFCSPYLIGWVTTQTGSSAIGMYLITGVLLFGATLVLRI 425 Lambda K H 0.327 0.141 0.438 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 565 Number of extensions: 30 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 438 Length of database: 432 Length adjustment: 32 Effective length of query: 406 Effective length of database: 400 Effective search space: 162400 Effective search space used: 162400 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.7 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory