Align Fructose-specific PTS system, I, HPr, and IIA components (characterized)
to candidate AO353_08465 AO353_08465 phosphoenolpyruvate-protein phosphotransferase
Query= reanno::pseudo3_N2E3:AO353_05485 (953 letters) >FitnessBrowser__pseudo3_N2E3:AO353_08465 Length = 759 Score = 333 bits (853), Expect = 3e-95 Identities = 202/562 (35%), Positives = 318/562 (56%), Gaps = 18/562 (3%) Query: 405 VAAAPGIAIGPAHIQVLQAIDYPLRGESTAIERER----LKTSLADVRRDIEGLIQRSKA 460 V +PG A+G A + +L D + + T + E KT++ VR D+ L + Sbjct: 181 VPGSPGAAVGTA-VVMLPPADLDVVPDKTIADIEAELGLFKTAIEGVRADMRALSAKLAT 239 Query: 461 KAI---REIFITHQEMLDDPELTDEVDTRLKQGESAEAAWMAVIDAAARQQESLQDALLA 517 + R +F + MLDD L EV T +K G+ A+ A V+ + E + DA L Sbjct: 240 QLRPEERALFDVYLMMLDDASLGSEVTTVIKTGQWAQGALRQVVTDHVNRFELMDDAYLR 299 Query: 518 ERAADLRDIGRRVLAQLCGI--ETPSEPDQPYILVMDEVGPSDVARLDPTRVAGILTARG 575 ERA+D++D+GRR+LA L +T PD IL+ +E+ P+ + + ++ G+++ G Sbjct: 300 ERASDVKDLGRRLLAYLQEERQQTLVYPDNT-ILISEELTPAMLGEVPEGKLVGLVSVLG 358 Query: 576 GATAHSAIVARALGIPALVGAGAAVLRLASGTPLLLDGQRGRLHVDADAATLQRAAEERD 635 +H AI+ARA+GIP ++G G +++DG G ++ + ++ A+ + Sbjct: 359 SGNSHVAILARAMGIPTVMGLVDLPYSKVDGIQMIVDGYHGEVYTNPSDVLRKQFADVVE 418 Query: 636 NREQRLQAAAAQRHQPALTTDGHAVEVFANIGESAGVVSAVEQGAEGIGLLRTELIFMAH 695 +Q A R P +T DGH + ++ N G A V A ++GAEG+GL RTE+ FM + Sbjct: 419 EEKQLALGLDALRDLPCVTIDGHRMPLWVNTGLLADVARAQKRGAEGVGLYRTEVPFMIN 478 Query: 696 QQAPDEATQEVEYRRVLDGLAGRPLVVRTLDVGGDKPLPYWPIAKEENPFLGVRGIRLTL 755 Q+ P E Q YR L +P+ +R+LD+GGDK L Y+PI KE+NPFLG RGIR+TL Sbjct: 479 QRFPSEKEQLAIYREQLAAFHPQPVTMRSLDIGGDKSLSYFPI-KEDNPFLGWRGIRVTL 537 Query: 756 QRPQIMEAQLRALLRAADN-RPLRIMFPMVGSVDEWRQARDMTERLRLEI-----PVADL 809 P+I Q RA+L+A++ LRI+ PM+ E +A + R E+ V Sbjct: 538 DHPEIFLVQTRAMLKASEGLNNLRILLPMISGTHELEEALHLIHRAWGEVRDEGTDVPMP 597 Query: 810 QLGIMIEVPSAALLAPVLAKEVDFFSVGTNDLTQYTLAIDRGHPTLSAQADGLHPAVLQL 869 +G+MIE+P+A LA++VDF SVG+NDLTQY LA+DR +P ++ D LHPAVLQ Sbjct: 598 PVGVMIEIPAAVYQTKELARQVDFLSVGSNDLTQYLLAVDRNNPRVADLYDYLHPAVLQA 657 Query: 870 IDITVRAAHAHGKWVGVCGELAADPLAVPVLVGLGVDELSVSARSIGEVKARVRELSLAQ 929 + VR AHA GK V +CGE+A DP A +L+ +G D LS++A ++ +VK +R+++L+ Sbjct: 658 LQTVVRDAHAEGKPVSICGEMAGDPAAAVLLMAMGFDSLSMNATNLPKVKWMLRQINLSW 717 Query: 930 VKHLAQLALAVGSANEVRALVE 951 + L + + + + + ++ Sbjct: 718 ARDLLAELMTIDNPQVIHSSLQ 739 Lambda K H 0.319 0.135 0.383 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 1389 Number of extensions: 64 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 953 Length of database: 759 Length adjustment: 42 Effective length of query: 911 Effective length of database: 717 Effective search space: 653187 Effective search space used: 653187 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 56 (26.2 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the paper from 2022 on GapMind for carbon sources, or view the source code.
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory