Align L-2,4-diketo-3-deoxyrhamnonate hydrolase; 2,4-dioxopentanoate hydrolase (characterized)
to candidate AO353_08500 AO353_08500 hypothetical protein
Query= reanno::Smeli:SM_b21112 (281 letters) >FitnessBrowser__pseudo3_N2E3:AO353_08500 Length = 221 Score = 115 bits (287), Expect = 1e-30 Identities = 72/212 (33%), Positives = 108/212 (50%), Gaps = 12/212 (5%) Query: 71 GKFICIGLNYSDHAAETGATVPPEPIIFMKATSAIVGPNDDLVLPRGSEKTDWEVELGIV 130 GK +CIG NY++HA E VP EP++F+K S +V +P +E E+ ++ Sbjct: 18 GKVVCIGRNYAEHAKELDNPVPTEPLLFIKPGSCVVPLEGGFAIPTERGSVHYEAEIAVL 77 Query: 131 IGK-TAKYVSEAEALDYVAGYCTVHDVSERAFQTERHGQ---WTKGKSCDTFGPTGPWLV 186 IGK + S E LD ++G+ D++ R Q E + W KS D P++V Sbjct: 78 IGKPLSTKPSREEVLDAISGFAPGLDLTLRDKQAELKSKGLPWEISKSFDGACVLAPFVV 137 Query: 187 TKDEVADPQDLAMWLKVNGETMQDGSTKTMVYGAAHLVSYLSQFMSLRPGDIISTGTPPG 246 + D D+ + L +NGE QDG++ M+ ++ Y++ SL+ GD+I TGTP G Sbjct: 138 S-STFPDLTDIGIRLTINGEVRQDGNSSLMLNPIVPMIQYMAGCFSLQAGDVIMTGTPAG 196 Query: 247 VGMGMKPPRYLKAGDVVELGIEGLGSQKQRVR 278 VG L GD + L + G GS K VR Sbjct: 197 VGP-------LNVGDELVLELPGAGSFKSSVR 221 Lambda K H 0.315 0.136 0.408 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 188 Number of extensions: 8 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 281 Length of database: 221 Length adjustment: 24 Effective length of query: 257 Effective length of database: 197 Effective search space: 50629 Effective search space used: 50629 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (22.0 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory