Align ABC transporter for L-Fucose, permease component 2 (characterized)
to candidate AO353_25890 AO353_25890 sugar ABC transporter permease
Query= reanno::Smeli:SM_b21105 (288 letters) >FitnessBrowser__pseudo3_N2E3:AO353_25890 Length = 276 Score = 149 bits (377), Expect = 5e-41 Identities = 81/263 (30%), Positives = 146/263 (55%), Gaps = 11/263 (4%) Query: 27 LVICLPGLWIVLSSLRPTVEIMAKPPVWIPETLSLDAYRAMFSGAGQGGVPVWDYFRNSL 86 ++I P W+VL+S + ++ A PP +I T +L+ Y + +G + + NS+ Sbjct: 23 ILIFFPIFWMVLTSFKTEIDAFATPPQFI-FTPTLENYLHVNERSGY-----FSFAWNSV 76 Query: 87 IVSVTSTVIALAIGLSGGYAFARYRFKAKSAIFLGFMLTRAVPGIALSLPLFMLYARTGI 146 ++S ++T + L I + Y+ A Y + L + T+ +P + + +P+++L G+ Sbjct: 77 VISFSATALCLLIAVPAAYSMAFYETQRTKGTLLWMLSTKMLPPVGVLMPIYLLAKSFGL 136 Query: 147 IDTHFSLILTYVALNVPFTIWLIDGFFRQVPKDLAEAAQIDGCTPWQAFWQVEFPLAGPG 206 +DT +LI+ Y +N+P +W+I +F+ +PKD+ EAA++DG T WQ +V P+A G Sbjct: 137 LDTRIALIIIYTLINLPIVVWMIYTYFKDIPKDILEAARLDGATLWQEMVRVLLPIAKGG 196 Query: 207 IASAGIFAFLTSWNEYALASQITRSVNSKTLPVGLL--DYTAEFTIDWRGMCALAVVMIV 264 +AS + + + WNE + +T +SK P+ L Y++ + W + A++ + Sbjct: 197 LASTVLLSLILCWNEAFWSLNLT---SSKAAPLTALIASYSSPEGLFWAKLSAVSTLACA 253 Query: 265 PALTLTFIIQKHLVSGLTFGAVK 287 P L +I QK LV GL+FGAVK Sbjct: 254 PILIFGWISQKQLVRGLSFGAVK 276 Lambda K H 0.328 0.141 0.442 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 225 Number of extensions: 13 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 288 Length of database: 276 Length adjustment: 26 Effective length of query: 262 Effective length of database: 250 Effective search space: 65500 Effective search space used: 65500 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.8 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory