Align ABC transporter for L-Fucose, ATPase component (characterized)
to candidate AO353_25130 AO353_25130 ABC transporter
Query= reanno::Smeli:SM_b21106 (365 letters) >FitnessBrowser__pseudo3_N2E3:AO353_25130 Length = 381 Score = 302 bits (774), Expect = 9e-87 Identities = 171/368 (46%), Positives = 232/368 (63%), Gaps = 16/368 (4%) Query: 1 MAPVTLKKLVKRYGALEVVHGIDLEVKDREFIALVGPSGCGKSTTLRMIAGLEEVSGGAI 60 M + L + K+ G + ++ + LE+ EF+ VGPSGCGKST LR+IAGL+ + G + Sbjct: 1 MIKLKLDNVNKQLGGVRILRDVSLEIAAGEFVVFVGPSGCGKSTLLRLIAGLDSICAGDL 60 Query: 61 EIGGRKVNDLPPRARNISMVFQSYALYPHMTVAENMGFSLKIAGRPAEEIKTRVAEAAAI 120 I R+VNDL PR R + MVFQSYALYPHM+V +N+ F LK+A ++ RV A I Sbjct: 61 LIDERRVNDLEPRERGVGMVFQSYALYPHMSVYDNISFGLKLAKTEKSSLRERVLRTAQI 120 Query: 121 LDLAHLLERRPSQLSGGQRQRVAMGRAIVRQPDVFLFDEPLSNLDAKLRTQVRTEIKKLH 180 L L LL+R+P +LSGGQRQRVAMGRA+ R+PD+ LFDEPLSNLDA LR Q+R EI +LH Sbjct: 121 LQLDKLLQRKPKELSGGQRQRVAMGRAMAREPDILLFDEPLSNLDASLRVQMRNEIARLH 180 Query: 181 ARMQATMIYVTHDQVEAMTLSDRIVIMRDGHIEQVGTPEDVFRRPATKFVAGFIGSPPMN 240 AR+ +TMIYVTHDQVEAMTL+D+IV++ G +EQVG+P +++ RPA++FVAGF+GSP MN Sbjct: 181 ARLGSTMIYVTHDQVEAMTLADKIVVLNGGRVEQVGSPRELYERPASRFVAGFLGSPRMN 240 Query: 241 MEEAVL-TDGKLAFASGATLPLP--PRFRSLVREGQKVTFGLRPDDVYPSGHGLHAGDAD 297 A L G+ + L + P S + ++ G+RP+ V L A D Sbjct: 241 FLAARLHAPGETSLVDTPVLGMTSLPFDSSNLAADTPLSLGVRPEHV-----SLKAADG- 294 Query: 298 AVHEIELPVTITEPLGNETLVFTQFNGRD--WVSRMLNPRPLRPGEAVPMSFDLARAHLF 355 + + VT E LG+ET V G+D + R + G+ V + D+ HLF Sbjct: 295 ---TVGVIVTGVEYLGSETYVHLD-TGQDDPLICRCEVNAGWQVGDRVELQLDIGNLHLF 350 Query: 356 DGETGRAL 363 D + G AL Sbjct: 351 DAD-GTAL 357 Lambda K H 0.320 0.137 0.397 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 376 Number of extensions: 14 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 365 Length of database: 381 Length adjustment: 30 Effective length of query: 335 Effective length of database: 351 Effective search space: 117585 Effective search space used: 117585 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory