Align 5-dehydro-4-deoxyglucarate dehydratase (EC 4.2.1.41) (characterized)
to candidate AO353_05305 AO353_05305 5-dehydro-4-deoxyglucarate dehydratase
Query= reanno::pseudo1_N1B4:Pf1N1B4_1110 (303 letters) >lcl|FitnessBrowser__pseudo3_N2E3:AO353_05305 AO353_05305 5-dehydro-4-deoxyglucarate dehydratase Length = 303 Score = 582 bits (1501), Expect = e-171 Identities = 291/303 (96%), Positives = 300/303 (99%) Query: 1 MNPQELKSILSSGLLSFPVTDFNAQGDFHRAGYIKRLEWLAPYGASALFAAGGTGEFFSL 60 MNPQELKSILSSGLLSFPVTDFNAQGDFHRAGYIKRLEWLAPYGASALFAAGGTGEFFSL Sbjct: 1 MNPQELKSILSSGLLSFPVTDFNAQGDFHRAGYIKRLEWLAPYGASALFAAGGTGEFFSL 60 Query: 61 AASEYSEIIKTAVDTCATSVPILAGVGGATRQAIEYAQEAERLGAKGLLLLPHYLTEASQ 120 AASEYSE+IKTAVDTCA+SVPILAGVGG+TRQAIEYAQEAERLGAKGLLLLPHYLTEASQ Sbjct: 61 AASEYSEVIKTAVDTCASSVPILAGVGGSTRQAIEYAQEAERLGAKGLLLLPHYLTEASQ 120 Query: 121 DGVAAHVEAVCKSVKIGVVVYNRNVCRLTAPLLERLAERCPNLIGYKDGLGDIELMVSIR 180 DGVAAHVEAVCKSVKIGV+VYNRNVCRLTAPLLERLAERCPNLIGYKDGLGDIELMVSIR Sbjct: 121 DGVAAHVEAVCKSVKIGVIVYNRNVCRLTAPLLERLAERCPNLIGYKDGLGDIELMVSIR 180 Query: 181 RRLGDRFSYLGGLPTAEVYAAAYKALGVPVYSSAVFNFIPKTAMDFYHAIAREDHATVGK 240 RRLGDRFSYLGGLPTAEVYAAAYKALGVPVYSSAVFNF+PK AMDFYHAIAR+DHATVGK Sbjct: 181 RRLGDRFSYLGGLPTAEVYAAAYKALGVPVYSSAVFNFLPKMAMDFYHAIARDDHATVGK 240 Query: 241 IIDDFFLPYLDIRNRKAGYAVSIVKAGAKIAGYDAGPVRAPLTDLTGEEYEMLAALIDKQ 300 +IDDFFLPYLDIRNRKAGYAVSIVKAGAKIAGYDAGPVR PLTDLT EE+EMLAAL+DKQ Sbjct: 241 LIDDFFLPYLDIRNRKAGYAVSIVKAGAKIAGYDAGPVRTPLTDLTPEEFEMLAALMDKQ 300 Query: 301 GAQ 303 GAQ Sbjct: 301 GAQ 303 Lambda K H 0.320 0.137 0.399 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 482 Number of extensions: 8 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 303 Length of database: 303 Length adjustment: 27 Effective length of query: 276 Effective length of database: 276 Effective search space: 76176 Effective search space used: 76176 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 48 (23.1 bits)
Align candidate AO353_05305 AO353_05305 (5-dehydro-4-deoxyglucarate dehydratase)
to HMM TIGR03249 (kdgD: 5-dehydro-4-deoxyglucarate dehydratase (EC 4.2.1.41))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.carbon/TIGR03249.hmm # target sequence database: /tmp/gapView.3266.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR03249 [M=299] Accession: TIGR03249 Description: KdgD: 5-dehydro-4-deoxyglucarate dehydratase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.7e-135 436.9 0.0 1.9e-135 436.7 0.0 1.0 1 lcl|FitnessBrowser__pseudo3_N2E3:AO353_05305 AO353_05305 5-dehydro-4-deoxyglu Domain annotation for each sequence (and alignments): >> lcl|FitnessBrowser__pseudo3_N2E3:AO353_05305 AO353_05305 5-dehydro-4-deoxyglucarate dehydratase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 436.7 0.0 1.9e-135 1.9e-135 1 297 [. 3 299 .. 3 301 .. 0.99 Alignments for each domain: == domain 1 score: 436.7 bits; conditional E-value: 1.9e-135 TIGR03249 1 pqelkkkigsGllsfPvtpfdadgsldeaalrenieflldedlealfvagGtGeffsltkaeveq 65 pqelk ++sGllsfPvt+f+a+g+++ a + +++e+l++++++alf+agGtGeffsl +e+++ lcl|FitnessBrowser__pseudo3_N2E3:AO353_05305 3 PQELKSILSSGLLSFPVTDFNAQGDFHRAGYIKRLEWLAPYGASALFAAGGTGEFFSLAASEYSE 67 89*************************************************************** PP TIGR03249 66 vvevaveaakgkvPvlagvGgnlsvaieiaraaekkGadGllllPpylieaeqeGlaayvkavie 130 v++ av++++ vP+lagvGg++++aie+a++ae+ Ga+GllllP+yl+ea+q+G+aa+v+av++ lcl|FitnessBrowser__pseudo3_N2E3:AO353_05305 68 VIKTAVDTCASSVPILAGVGGSTRQAIEYAQEAERLGAKGLLLLPHYLTEASQDGVAAHVEAVCK 132 ***************************************************************** PP TIGR03249 131 svdlgvivyqrdnavleadtlerlaerlpnlvGfkdGiGdiekvieitqklGdrllylgGlPtae 195 sv++gvivy+r+ + l+a+ lerlaer+pnl+G+kdG+Gdie +++i+++lGdr+ ylgGlPtae lcl|FitnessBrowser__pseudo3_N2E3:AO353_05305 133 SVKIGVIVYNRNVCRLTAPLLERLAERCPNLIGYKDGLGDIELMVSIRRRLGDRFSYLGGLPTAE 197 ***************************************************************** PP TIGR03249 196 vtalaylalGvtsyssaifnfiPkiarkfyealrkgdeatvkeilkevilPiveirnrkkGyavs 260 v+a+ay+alGv +yssa+fnf+Pk+a++fy+a++++d+atv +++++++lP++ irnrk+Gyavs lcl|FitnessBrowser__pseudo3_N2E3:AO353_05305 198 VYAAAYKALGVPVYSSAVFNFLPKMAMDFYHAIARDDHATVGKLIDDFFLPYLDIRNRKAGYAVS 262 ***************************************************************** PP TIGR03249 261 likaGlevvGrdvgpvraPlvdlekeelaeleellkk 297 ++kaG+++ G d+gpvr+Pl+dl+ ee++ l++l++k lcl|FitnessBrowser__pseudo3_N2E3:AO353_05305 263 IVKAGAKIAGYDAGPVRTPLTDLTPEEFEMLAALMDK 299 *********************************9987 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (299 nodes) Target sequences: 1 (303 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.01s 00:00:00.02 Elapsed: 00:00:00.01 # Mc/sec: 7.39 // [ok]
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the paper from 2022 on GapMind for carbon sources, or view the source code.
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory