Align ABC transporter for D-Glucosamine, periplasmic substrate-binding component (characterized)
to candidate AO353_12320 AO353_12320 amino acid ABC transporter substrate-binding protein
Query= reanno::pseudo5_N2C3_1:AO356_00480 (282 letters) >FitnessBrowser__pseudo3_N2E3:AO353_12320 Length = 265 Score = 89.0 bits (219), Expect = 1e-22 Identities = 76/258 (29%), Positives = 115/258 (44%), Gaps = 15/258 (5%) Query: 14 LFAATTAAMGVAQAADSKLDSVLQRGKLIVGTGSTNAPWHFQGADGKLQGFDIDIARMVA 73 L TA + V A +D ++RG L VG T P+ G++ GF++DI + +A Sbjct: 8 LLLGVTALVAVNAAHAGAIDDAVKRGTLKVGMDPTYMPFEMTNKRGEIIGFEVDILKAMA 67 Query: 74 KGLFNDPEKVEFVVQSSDARIPNLLTDKVDMSCQFITVTASRAQQVAFTLPYYREGVGLL 133 K + K+E V D IP L+TDK DM +T+T R ++ F+ P+ G LL Sbjct: 68 KAM---GVKLEMVSTGYDGIIPALMTDKFDMIGSGMTLTQERNLRLNFSEPFIVVGQTLL 124 Query: 134 L--PANSKYKEIEDLKAAGDDVTVAVLQNVYAEELVHQALPKAKVDQYDSVDLMYQAVNS 191 + +DL A D + E + + + KAK YD+ V + Sbjct: 125 IRKELEGTITSYKDLNTA--DYRITSKLGTTGEMVAKKLISKAKYHGYDNEQEAVLDVVN 182 Query: 192 GRADAAATDQSSVKYLMVQNPGRYRSPAYAWSPQTY---ACAVKRGDQDWLNFVNTTLHE 248 G+ADA D + + V G + + P TY A +K+GD D +NF+N LH+ Sbjct: 183 GKADAFIYD-APYNVVAVNKVGNGKL-VFLDKPFTYEPLAFGLKKGDYDSINFINNFLHQ 240 Query: 249 AMTGVEFPTYAASFKQWF 266 E TY +WF Sbjct: 241 IH---EDGTYDRIHDKWF 255 Lambda K H 0.319 0.132 0.390 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 175 Number of extensions: 10 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 282 Length of database: 265 Length adjustment: 25 Effective length of query: 257 Effective length of database: 240 Effective search space: 61680 Effective search space used: 61680 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory