Align ABC transporter for D-glucosamine, ATPase component (characterized)
to candidate AO353_28150 AO353_28150 arginine aminotransferase
Query= reanno::pseudo3_N2E3:AO353_21725 (265 letters) >FitnessBrowser__pseudo3_N2E3:AO353_28150 Length = 667 Score = 260 bits (664), Expect = 6e-74 Identities = 137/251 (54%), Positives = 182/251 (72%), Gaps = 1/251 (0%) Query: 11 ASQALLEIRDLHKQYGPLEVLKGVDLTMQRGNVVTLIGSSGSGKTTLLRCVNMLEEFQGG 70 A++ ++E+ LHK++G +EVLKGV LT + G+V++LIG+SGSGK+TLLRC+NMLE G Sbjct: 411 AAKTMIEVDGLHKRFGNIEVLKGVSLTAREGDVISLIGASGSGKSTLLRCINMLEVPDQG 470 Query: 71 QILLDGESIGYH-EVNGKRVRHSEKVIAQHRAMTGMAFQQFNLFPHLTALQNVTLGLLKV 129 +IL+DGESI + + G + K + + R+ GM FQ FNL+PH T L+N+ +V Sbjct: 471 RILVDGESIQLNFDRPGAPLVSDAKQLVRIRSSLGMVFQNFNLWPHRTVLENLIEAPTQV 530 Query: 130 KKLHKDEAVVLAEKWLERVGLLERRDHYPGQLSGGQQQRVAIARAIAMNPSLMLFDEVTS 189 + + EA AE LERVGL +R+ YP LSGGQQQRVAIARA+AM P +MLFDE TS Sbjct: 531 LRESRAEATERAEALLERVGLAAKRNEYPAFLSGGQQQRVAIARALAMRPKVMLFDEPTS 590 Query: 190 ALDPELVGEVLSVIKGLAEDGMTMLLVTHEMRFAFEVSDKIVFMNQGRIEEQGPPKELFE 249 ALDPELVGEVL VI+ LAE+G TM+LVTHEM FA +VS K+ +++QG IEE G P E+F Sbjct: 591 ALDPELVGEVLRVIRSLAEEGRTMILVTHEMAFARDVSSKVAYLHQGLIEEAGSPDEVFV 650 Query: 250 RPQSPRLAEFL 260 P+S R +F+ Sbjct: 651 HPRSERCRQFV 661 Lambda K H 0.319 0.135 0.379 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 382 Number of extensions: 14 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 265 Length of database: 667 Length adjustment: 31 Effective length of query: 234 Effective length of database: 636 Effective search space: 148824 Effective search space used: 148824 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory