Align ABC transporter for D-Glucosamine, permease component 2 (characterized)
to candidate AO353_25120 AO353_25120 ABC transporter permease
Query= reanno::Smeli:SM_b21220 (293 letters) >FitnessBrowser__pseudo3_N2E3:AO353_25120 Length = 320 Score = 214 bits (545), Expect = 2e-60 Identities = 117/291 (40%), Positives = 176/291 (60%), Gaps = 17/291 (5%) Query: 10 AWLLMLPLLVVMTAVIGWPLVDTVRLSFTDAKLVGTEGG-FVGTANYIKMLGGSNFQRAL 68 AWL + P+L+ + V WPL+ T S TDA L T GG FVG +NY+ GSN+ L Sbjct: 29 AWLFLTPMLLCLALVAAWPLLRTFWFSLTDANLADTSGGSFVGLSNYL-FHDGSNWSGIL 87 Query: 69 VTTTW---------FAVISVAAEMVLGVLAALLLNQQFRGRTALRALMILPWALPTVVNA 119 V W F V+SV E+VLG+L ALLLN +F GR+ +RAL+++PWA+PT+V+A Sbjct: 88 VDPQWWNAVRNTLHFTVVSVGLEIVLGLLVALLLNIKFTGRSLVRALILIPWAIPTIVSA 147 Query: 120 TLWRLIYNPEYGALNAALTQLGLLDSYRSWLGEPGTALAALIVADCWKNFPLVALIALAA 179 +W + N ++G +N + LGL+D+ +W + ++ A+I+ D WK P V L+ LAA Sbjct: 148 KIWSWMLNDQFGIINHLMLSLGLIDAPLAWTADADLSMWAVIIVDVWKTVPFVTLLMLAA 207 Query: 180 LQAVPRDITAASLVDGAGPFNRFRFVIMPYLAGPLLVALVLRTIEAFKVFDIIWVMTRGG 239 LQ +P D A+ VDG P F V +P L LLVA + R +++ +VFD+I+V+T Sbjct: 208 LQMLPSDCYEAARVDGIHPLKVFWRVTLPLLMPALLVAAIFRILDSLRVFDVIYVLT--- 264 Query: 240 PANSTRTLSILVY--QEAFSFQRAGSGASLALIVTLLVTILAAAYAALLRK 288 +NS+ T+S+ VY Q FQ G G++ + ++ L+V ++A Y L R+ Sbjct: 265 -SNSSSTMSMSVYARQHLVEFQDVGYGSAASTLLFLVVAVIAMLYLYLGRR 314 Lambda K H 0.326 0.138 0.417 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 267 Number of extensions: 11 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 293 Length of database: 320 Length adjustment: 27 Effective length of query: 266 Effective length of database: 293 Effective search space: 77938 Effective search space used: 77938 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.7 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory