Align Glucose-6-P:Pi antiporter, Hpt (may also transport other organophosphates including C3 organophosphates) (characterized)
to candidate AO353_08820 AO353_08820 glycerol-3-phosphate transporter
Query= TCDB::Q9Z7N9 (455 letters) >FitnessBrowser__pseudo3_N2E3:AO353_08820 Length = 449 Score = 342 bits (876), Expect = 2e-98 Identities = 182/443 (41%), Positives = 263/443 (59%), Gaps = 18/443 (4%) Query: 7 FFQPPKHIKEIEDQEVVKKKYKYWRIRIFYSMFIGYIFYYFTRKSFTFAMPTLIADLGFD 66 FF+P H + ++ V Y+ R +IF +F GY YY RK+F+ AMP LI D G+ Sbjct: 4 FFRPAAHQAPLPEEHV-DSTYRRLRWQIFAGIFFGYAGYYLLRKNFSLAMPYLI-DEGYT 61 Query: 67 KAQLGIIGSTLYFSYGISKFVSGVMSDQSNPRYFMAIGLMITGLTNIFFGMS----SSIV 122 + QLG+ S + +YG+SKF+ G++SD+SNPRYF+ GL+++ FG + SS+ Sbjct: 62 RGQLGLAMSAIAIAYGLSKFLMGLVSDRSNPRYFLPFGLLVSAGVMFIFGFAPWATSSVT 121 Query: 123 LFALWWGLNGWFQGWGWPPCARLLTHWYAKSERGTWWSVWSTSHNIGGALI-PILTGFII 181 + + +NGW QG GWPP R + HW+++ ERG SVW+ +HN+GG LI P+ + Sbjct: 122 MMFILLFINGWAQGMGWPPSGRTMVHWWSQKERGGVVSVWNVAHNVGGGLIGPLFLLGMG 181 Query: 182 DYSGWRGAMYVPGILCIGMGLVLINRLRDTPQSLGLPPIEKYKRDPHHAHHEGKSASEGT 241 ++ W A YVP + + + + +RDTPQS+GLPPIEKYK D + EG AS Sbjct: 182 LFNDWHAAFYVPAAVALLVAVFAFMVMRDTPQSVGLPPIEKYKND----YPEGYDASH-- 235 Query: 242 EEIERELSTREILFTYVLTNQWLWFLAAASFFIYIVRMAVNDWSALFLIETKHYAAVKAN 301 E E S +EI YVL N+ LW++A A+ F+Y++R V DW+ +L E KH+ K + Sbjct: 236 ---EDEFSAKEIFVKYVLRNKMLWYIAMANVFVYLLRYGVLDWAPTYLKEAKHFDVDKTS 292 Query: 302 FCVSLFEIGGLFGMLVAGWLSDKISKGNRGPMNVLFSLGLLFAILGMWFSRSHNQWWVDG 361 + +E G+ G L+ GW+SDKI +GNRG ++F + A L W + + N +D Sbjct: 293 WAYFFYEWAGIPGTLLCGWMSDKIFRGNRGLTGMVFMALVTVATLVYWLNPAGNP-TIDM 351 Query: 362 TLLFVIGFFLYGPQMMIGLAAAELSHKKAAGTASGFTGWFAYFGATF-AGYPLGKVTDVW 420 LF IGF +YGP M+IGL A EL+ KKAAGTA+GFTG F Y G + A +G D + Sbjct: 352 IALFSIGFLIYGPVMLIGLQALELAPKKAAGTAAGFTGLFGYLGGSVAASAAMGYTVDHF 411 Query: 421 GWKGFFIALLACASIALLLFLPT 443 GW G F+ L+ +A+ PT Sbjct: 412 GWDGGFVLLVGACLLAMACLAPT 434 Lambda K H 0.327 0.141 0.476 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 822 Number of extensions: 43 Number of successful extensions: 6 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 455 Length of database: 449 Length adjustment: 33 Effective length of query: 422 Effective length of database: 416 Effective search space: 175552 Effective search space used: 175552 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.7 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory