GapMind for catabolism of small carbon sources


Aligments for a candidate for kdgD in Pseudomonas fluorescens FW300-N2E3

Align 5-dehydro-4-deoxyglucarate dehydratase (EC (characterized)
to candidate AO353_05305 AO353_05305 5-dehydro-4-deoxyglucarate dehydratase

Query= reanno::pseudo1_N1B4:Pf1N1B4_1110
         (303 letters)

>lcl|FitnessBrowser__pseudo3_N2E3:AO353_05305 AO353_05305
           5-dehydro-4-deoxyglucarate dehydratase
          Length = 303

 Score =  582 bits (1501), Expect = e-171
 Identities = 291/303 (96%), Positives = 300/303 (99%)






Query: 301 GAQ 303
Sbjct: 301 GAQ 303

Lambda     K      H
   0.320    0.137    0.399 

Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 482
Number of extensions: 8
Number of successful extensions: 1
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 303
Length of database: 303
Length adjustment: 27
Effective length of query: 276
Effective length of database: 276
Effective search space:    76176
Effective search space used:    76176
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 48 (23.1 bits)

Align candidate AO353_05305 AO353_05305 (5-dehydro-4-deoxyglucarate dehydratase)
to HMM TIGR03249 (kdgD: 5-dehydro-4-deoxyglucarate dehydratase (EC

# hmmsearch :: search profile(s) against a sequence database
# HMMER 3.3.1 (Jul 2020);
# Copyright (C) 2020 Howard Hughes Medical Institute.
# Freely distributed under the BSD open source license.
# - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
# query HMM file:                  ../tmp/path.carbon/TIGR03249.hmm
# target sequence database:        /tmp/gapView.16789.genome.faa
# - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query:       TIGR03249  [M=299]
Accession:   TIGR03249
Description: KdgD: 5-dehydro-4-deoxyglucarate dehydratase
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence                                     Description
    ------- ------ -----    ------- ------ -----   ---- --  --------                                     -----------
   1.7e-135  436.9   0.0   1.9e-135  436.7   0.0    1.0  1  lcl|FitnessBrowser__pseudo3_N2E3:AO353_05305  AO353_05305 5-dehydro-4-deoxyglu

Domain annotation for each sequence (and alignments):
>> lcl|FitnessBrowser__pseudo3_N2E3:AO353_05305  AO353_05305 5-dehydro-4-deoxyglucarate dehydratase
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  436.7   0.0  1.9e-135  1.9e-135       1     297 [.       3     299 ..       3     301 .. 0.99

  Alignments for each domain:
  == domain 1  score: 436.7 bits;  conditional E-value: 1.9e-135
                                     TIGR03249   1 pqelkkkigsGllsfPvtpfdadgsldeaalrenieflldedlealfvagGtGeffsltkaeveq 65 
                                                   pqelk  ++sGllsfPvt+f+a+g+++ a + +++e+l++++++alf+agGtGeffsl  +e+++
                                                   89*************************************************************** PP

                                     TIGR03249  66 vvevaveaakgkvPvlagvGgnlsvaieiaraaekkGadGllllPpylieaeqeGlaayvkavie 130
                                                   v++ av++++  vP+lagvGg++++aie+a++ae+ Ga+GllllP+yl+ea+q+G+aa+v+av++
                                                   ***************************************************************** PP

                                     TIGR03249 131 svdlgvivyqrdnavleadtlerlaerlpnlvGfkdGiGdiekvieitqklGdrllylgGlPtae 195
                                                   sv++gvivy+r+ + l+a+ lerlaer+pnl+G+kdG+Gdie +++i+++lGdr+ ylgGlPtae
                                                   ***************************************************************** PP

                                     TIGR03249 196 vtalaylalGvtsyssaifnfiPkiarkfyealrkgdeatvkeilkevilPiveirnrkkGyavs 260
                                                   v+a+ay+alGv +yssa+fnf+Pk+a++fy+a++++d+atv +++++++lP++ irnrk+Gyavs
                                                   ***************************************************************** PP

                                     TIGR03249 261 likaGlevvGrdvgpvraPlvdlekeelaeleellkk 297
                                                   ++kaG+++ G d+gpvr+Pl+dl+ ee++ l++l++k
  lcl|FitnessBrowser__pseudo3_N2E3:AO353_05305 263 IVKAGAKIAGYDAGPVRTPLTDLTPEEFEMLAALMDK 299
                                                   *********************************9987 PP

Internal pipeline statistics summary:
Query model(s):                            1  (299 nodes)
Target sequences:                          1  (303 residues searched)
Passed MSV filter:                         1  (1); expected 0.0 (0.02)
Passed bias filter:                        1  (1); expected 0.0 (0.02)
Passed Vit filter:                         1  (1); expected 0.0 (0.001)
Passed Fwd filter:                         1  (1); expected 0.0 (1e-05)
Initial search space (Z):                  1  [actual number of targets]
Domain search space  (domZ):               1  [number of targets reported over threshold]
# CPU time: 0.01u 0.01s 00:00:00.02 Elapsed: 00:00:00.01
# Mc/sec: 6.87

This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.



Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the paper from 2022 on GapMind for carbon sources, or view the source code.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory