Align Probable 5-dehydro-4-deoxyglucarate dehydratase; EC 4.2.1.41; 5-keto-4-deoxy-glucarate dehydratase; KDGDH (uncharacterized)
to candidate AO353_14875 AO353_14875 4-hydroxy-tetrahydrodipicolinate synthase
Query= curated2:A4YNH1 (314 letters) >FitnessBrowser__pseudo3_N2E3:AO353_14875 Length = 305 Score = 112 bits (280), Expect = 1e-29 Identities = 86/292 (29%), Positives = 137/292 (46%), Gaps = 11/292 (3%) Query: 15 SGLLSFPVTPFKADYSFDETTYRSNMDWLCGYDVAGLFAAGGTGEFFSLTAAEVPEVVKV 74 SG+ T F D+S D + L V+GL G GE SL+ E +V+V Sbjct: 8 SGVFPAVTTQFNPDFSIDYEGTHKVISGLVRDGVSGLVICGTVGENTSLSTEEKISLVEV 67 Query: 75 AVDETKGRVPVLAGTG-YGTAIAREIAMSAEKAGADGLLLLPPYLMHAEQEGLAAHVEAV 133 A D GRVPV++G + +A A ++A ++ GADG++L+P + ++ AAH +V Sbjct: 68 AKDAAAGRVPVISGVAEFTSANASKVAKEIQRVGADGIMLMPALVYSSKPFETAAHFRSV 127 Query: 134 CKSVKIGVIVYNRDNAI---LQPDTLARLCERCPNLVGYKDGIGDIELMTRVYTKMGDRL 190 S+ + V+VYN + PD L L + C N+V +KD GD V ++GDR Sbjct: 128 AASIDLPVMVYNNPPIYRNDVTPDILISLAD-CDNVVCFKDSSGDTRRFIDVRNEVGDRF 186 Query: 191 TYIGGLPTAETFALPYLDMGVTTYSSAVFNFVPEFATNFYAAVRKRDHATIHAGLKDFIL 250 GL + L + +G + S + N P+ + R + ++ + Sbjct: 187 VLFAGL---DDVVLESIAVGAVGWVSGMSNAFPKEGETLFRLARDGRFKEA-MPIYEWFM 242 Query: 251 PLIAIRNRKKGYAVSIIKAGMKVIGRDSGPVRLPLTDLTEAEMAELTALVKA 302 PL+ + R V IK +++GR + R P L + E +E+ ALVKA Sbjct: 243 PLLHLDARPD--LVQCIKLCEELMGRGTALTRPPRLGLLDHERSEVEALVKA 292 Lambda K H 0.320 0.136 0.392 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 220 Number of extensions: 12 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 314 Length of database: 305 Length adjustment: 27 Effective length of query: 287 Effective length of database: 278 Effective search space: 79786 Effective search space used: 79786 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory