Align Possible transporter of polar amino acids including glutamate, glutamine and aspartate, DmeA. It complements a sepJ mutation in Anabaena (TC# 2.A.7.23.2), and SepJ complements a dmeA mutation. Alternatively, and less likely, it could be an activator of an ABC transporter catalyzing uptake of these amino acids (characterized)
to candidate AO353_26930 AO353_26930 multidrug transporter
Query= TCDB::Q31PG5 (330 letters) >FitnessBrowser__pseudo3_N2E3:AO353_26930 Length = 316 Score = 174 bits (441), Expect = 3e-48 Identities = 116/290 (40%), Positives = 163/290 (56%), Gaps = 12/290 (4%) Query: 19 PVSLQLAIATALWGGTFTAGRIAVQQLSPLAVACGRYLLATTVLLLILWQREGWPPLNR- 77 PV L+LA T +WGGTF AGR LSPL A R+LLA+ LLL + PL R Sbjct: 15 PVYLKLATVTMIWGGTFVAGRFLADSLSPLFAASLRFLLASLALLLFMVLAR--IPLARP 72 Query: 78 --RQQLLLFGLGVSGIALYNWLFFIGLSLIPASRAALIIALNPTAIALGAAIWTGDRLRS 135 RQ L L LG GI YN FF GL I ASRA+LI+ALNP I L + + +RL Sbjct: 73 TFRQWLQLGVLGFFGIFFYNVCFFYGLHYINASRASLIVALNPAVIGLASWLLFKERLSR 132 Query: 136 WQWAGVGLSLIGAILLLGSRQA----GALTLPGWGDLALVGCVLCWTVYSLLARQALRSL 191 + AG+ + + GA +++ SR G GDL + GCVL W +YSL ++ ++L Sbjct: 133 TKIAGIAICIAGAGVVIFSRNQPVFDGGAANSWIGDLLIFGCVLGWGIYSLFSKGLNQAL 192 Query: 192 SPLTVTTGACCWGSVLLIGLWLGQGA---QLPVNVSFSTGSAIAFLGLGGTALAFCLYAN 248 PL T + G+++L +G ++ ++ + ++ +LG+ G+ALA+ Y + Sbjct: 193 GPLHTVTYSIVLGTLMLCTTSAVRGEVSLEVLDDLQVTQLLSLLYLGVLGSALAYIWYYD 252 Query: 249 GIERLGAARAGLFINLVPVFGSAIGALLLQEPLSGLTLLGGLLVLAGVGL 298 GI R+GA R+G+FI L P+ +GALLL E LSG LGG +L G+ L Sbjct: 253 GIRRIGATRSGVFIALNPLTAVILGALLLGEQLSGAMYLGGAAILLGIYL 302 Lambda K H 0.325 0.142 0.454 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 289 Number of extensions: 15 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 330 Length of database: 316 Length adjustment: 28 Effective length of query: 302 Effective length of database: 288 Effective search space: 86976 Effective search space used: 86976 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.0 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.6 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory